BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31506 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharo... 34 0.022 SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 31 0.15 SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|ch... 30 0.27 SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyc... 30 0.36 SPAC22G7.05 |||krr family protein|Schizosaccharomyces pombe|chr ... 28 1.1 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 1.9 SPAC1834.07 |klp3|krp1|kinesin-like protein Klp3|Schizosaccharom... 27 2.5 SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1 |Schizo... 27 3.3 SPAC22F3.11c |snu23||U4/U6 x U5 tri-snRNP complex subunit Snu23|... 26 5.8 SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomy... 26 5.8 SPCC4B3.08 |||C-terminal domain kinase I |Schizosaccharomyces po... 26 5.8 SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy... 25 7.7 SPBC29A10.03c |rlf2|SPBC365.19c|chromatin remodeling complex sub... 25 7.7 >SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 33.9 bits (74), Expect = 0.022 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = +1 Query: 418 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEK 597 EEKR+++EE++K + +LQA + K N + KKS + + KE+ + EK Sbjct: 138 EEKRRKIEESDKWHRVLLQA--EGKKLKDNEQLLKKSIRRKEKEKKKSSDAWKERKDNEK 195 Query: 598 KISL 609 K L Sbjct: 196 KAML 199 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 31.1 bits (67), Expect = 0.15 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E + KR+A +A ++A + ++K++ NA+ E K K + E Sbjct: 620 EAEEKAKREAEEKAKREAEEKAKREAEEKAKR-EAEEKAKREAEENAKREAEEKAKREAE 678 Query: 589 EEKKISLSIRIKPLTIE 639 E K ++K T E Sbjct: 679 ENAKREAEEKVKRETEE 695 Score = 29.5 bits (63), Expect = 0.47 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E + KR+A +A ++A + ++K++ NA+ E K K + E Sbjct: 636 EAEEKAKREAEEKAKREAEEKAKREAEENAKR-EAEEKAKREAEENAKREAEEKVKRETE 694 Query: 589 EEKK 600 E K Sbjct: 695 ENAK 698 Score = 27.5 bits (58), Expect = 1.9 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E + KR+A +A ++A + ++K++ A+ E K K + E Sbjct: 572 EAEEKAKREAEEKAKREAEEKAKREAEENAKR-EAEEKAKREAEEKAKREAEEKAKREAE 630 Query: 589 EEKK 600 E+ K Sbjct: 631 EKAK 634 Score = 27.5 bits (58), Expect = 1.9 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQK-KSENFGLSNAQLERNKTKEQLE 588 + EEK +R E + KR+A +A ++A + +K K E + + E N +E E Sbjct: 612 EAEEKAKREAEEKAKREAEEKAKREAEEKAKREAEEKAKREAEEKAKREAEENAKREAEE 671 Query: 589 EEKK 600 + K+ Sbjct: 672 KAKR 675 Score = 26.6 bits (56), Expect = 3.3 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E + KR+A A ++A + ++K++ A+ E K K + E Sbjct: 580 EAEEKAKREAEEKAKREAEENAKREAEEKAKR-EAEEKAKREAEEKAKREAEEKAKREAE 638 Query: 589 EEKK 600 E+ K Sbjct: 639 EKAK 642 Score = 26.6 bits (56), Expect = 3.3 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E KR+A +A ++A + ++K++ A+ E K K + E Sbjct: 588 EAEEKAKREAEENAKREAEEKAKREAEEKAKR-EAEEKAKREAEEKAKREAEEKAKREAE 646 Query: 589 EEKK 600 E+ K Sbjct: 647 EKAK 650 Score = 26.6 bits (56), Expect = 3.3 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLE-RNKTKEQLE 588 + EEK +R E + KR+A +A ++A + ++K++ A+ E K K + E Sbjct: 604 EAEEKAKREAEEKAKREAEEKAKREAEEKAKR-EAEEKAKREAEEKAKREAEEKAKREAE 662 Query: 589 EEKK 600 E K Sbjct: 663 ENAK 666 Score = 25.8 bits (54), Expect = 5.8 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 421 EKRQRLEEAEK-KRQAMLQAMKDASKTGPNFTIQK-KSENFGLSNAQLERNKTKEQLEEE 594 E++ RLE E KR+A QA ++A + +K K E + + E N +E E+ Sbjct: 550 EEKARLEAEENAKREAEEQAKREAEEKAKREAEEKAKREAEEKAKREAEENAKREAEEKA 609 Query: 595 KK 600 K+ Sbjct: 610 KR 611 >SPAC27D7.02c |||GRIP domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 750 Score = 30.3 bits (65), Expect = 0.27 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +1 Query: 412 DIEEKRQRLEEAEKKRQAMLQAMKD----ASKTGPNFTIQKKSENFGLSNAQLERNKTKE 579 ++EEK LE A+ Q ++ ++KD +K + ++ G+S+A L + K K Sbjct: 162 ELEEKINSLESAQSIEQEVISSLKDDKTVETKNDVPEVSRPSTDTIGVSSA-LSKKKKKR 220 Query: 580 QLEEEKKISLSIRIKPLT 633 + +KK S I+ T Sbjct: 221 NRKNQKKKSTKQNIEATT 238 >SPAC1B3.05 |||CCR4-Not complex subunit Not3/5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 630 Score = 29.9 bits (64), Expect = 0.36 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 2/87 (2%) Frame = +1 Query: 424 KRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKE-QLEEEKK 600 ++++LE K + LQ ++D KT + S + A LE + E ++EE K Sbjct: 29 QKEKLEGDLKTQIKKLQRLRDQIKTWAS------SNDIKDKKALLENRRLIEAKMEEFKA 82 Query: 601 ISLSIRIKPLTIEGLSV-DKLRQKAQE 678 + ++IK + EGLS+ KL K +E Sbjct: 83 VEREMKIKAFSKEGLSIASKLDPKEKE 109 >SPAC22G7.05 |||krr family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 28.3 bits (60), Expect = 1.1 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = +1 Query: 436 LEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEK 597 +EE E+ R+ + A D + G + +S+ G + +++ KTK+QLEEE+ Sbjct: 197 VEEQERLRKETIAAFHDVN--GNKDAVSNESDEDG--DFLVKKEKTKKQLEEEE 246 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 1.9 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +1 Query: 424 KRQRLEEAEKKRQAMLQAMKDAS---KTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 594 K + +++R A +QA+ D S +T + + +SEN GL N ++ +QLE+E Sbjct: 232 KDHEILRLKEERTAAMQAIDDISGTIETIKSDCYKVESENKGLINEVMDMRNFVQQLEQE 291 >SPAC1834.07 |klp3|krp1|kinesin-like protein Klp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 502 PNFTIQKKSENFGLSNAQLERNKTKEQLEE-EKKISLSIRIKPLTIEGL 645 P FTI++K +NF ++N ERN ++L + ++ + ++ I+ L Sbjct: 490 PGFTIEQKDKNFSINN---ERNNFLQKLSTLDSSLAALVNVQRKLIKAL 535 >SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1336 Score = 26.6 bits (56), Expect = 3.3 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 264 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWISLTLLFRSG 148 P+FA + L LF+Q+ P + + FW S+ L+ +G Sbjct: 796 PIFAYVISKCLNLFMQIDPSIGVA---FWSSMVLVVAAG 831 >SPAC22F3.11c |snu23||U4/U6 x U5 tri-snRNP complex subunit Snu23|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/69 (21%), Positives = 36/69 (52%) Frame = +1 Query: 415 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 594 I EKR LEE +++ + + + + K ++++++ E + + +LE K + + ++ Sbjct: 65 IIEKRATLEEVKERMEYWRRQLLEPEKGSEEYSLKERVERY---HQELEAKKLRRKQKKV 121 Query: 595 KKISLSIRI 621 K S R+ Sbjct: 122 NKEKNSPRL 130 >SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 274 Score = 25.8 bits (54), Expect = 5.8 Identities = 16/64 (25%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +1 Query: 418 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTK--EQLEE 591 EEK +++EE E + + ++D K+ +++K S A+ +R+ + E LE+ Sbjct: 132 EEKDRKIEEGELTSEEEKEPIQDLRKSHKRKSVEKSSVPNKKHKAERKRSPSPKIEILED 191 Query: 592 EKKI 603 +++I Sbjct: 192 DEEI 195 >SPCC4B3.08 |||C-terminal domain kinase I |Schizosaccharomyces pombe|chr 3|||Manual Length = 218 Score = 25.8 bits (54), Expect = 5.8 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Frame = +1 Query: 415 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 594 + EK+ + K A ++A + ASK+G T S+N L + +R + K E Sbjct: 116 LHEKKVIDDNQYKDAMATVEAHEQASKSGDTSTSGAISKNDILKRIEEDRERHKRMRENI 175 Query: 595 KKIS---LSIRIKPLTIEGLSVDKLRQKAQE 678 IS L I T +G++ L E Sbjct: 176 WAISEPELEAEIAWNTTQGITESDLESLKDE 206 >SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.4 bits (53), Expect = 7.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 530 SLFFWMVKLGPVLLASFMAWSIAW 459 SL+FW L P +F++W + + Sbjct: 111 SLYFWTAYLSPPKYRAFLSWFLGY 134 >SPBC29A10.03c |rlf2|SPBC365.19c|chromatin remodeling complex subunit Rlf2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 544 Score = 25.4 bits (53), Expect = 7.7 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = +1 Query: 553 QLERNKTKEQLEEEKKISLSIRI---KPLTIEGLSVDKLRQKAQE 678 +L+R K ++Q E+EKK+ +I K +E L +++R + Q+ Sbjct: 97 RLKREKERQQREQEKKLREQEKIAAKKMKELEKLEKERIRLQEQQ 141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.131 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,851,693 Number of Sequences: 5004 Number of extensions: 25324 Number of successful extensions: 159 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -