BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31506 (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 6.7 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 8.9 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 8.9 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 264 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWI 175 PL P DVFL F V P + E W+ Sbjct: 12 PLSYPQTDVFLVCFSVVSPSSFENVKEKWV 41 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.0 bits (47), Expect = 8.9 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -1 Query: 682 RVPGPSVGVCR 650 ++PGP++ VCR Sbjct: 110 KIPGPTISVCR 120 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 619 CGWTGRSSSPLPAAPWSC 566 CG R S P A W+C Sbjct: 183 CGQVERKSQPFGPARWAC 200 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.131 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,426 Number of Sequences: 2352 Number of extensions: 6925 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -