BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31505 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 173 1e-43 SB_49884| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 2.8 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_48685| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_37830| Best HMM Match : Peptidase_C54 (HMM E-Value=3.3e-11) 27 8.7 SB_24186| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_41995| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 8.7 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 173 bits (420), Expect = 1e-43 Identities = 91/179 (50%), Positives = 114/179 (63%), Gaps = 5/179 (2%) Frame = +3 Query: 3 IDINHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPIS 182 IDI KH +K R E SQ++ TNAKFNQIV++RL MSR RPP+S Sbjct: 110 IDIEKKHPKKNYRREPVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLS 169 Query: 183 VSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILT 362 ++RL R MK + I VVVG++T+D R++++P + + AL +E ARARIL AGGEILT Sbjct: 170 LARLVRKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILT 229 Query: 363 FDQLALRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTK-----PYVRTKGHEKAR 524 FDQLALRAP G+ TVL+QG R AREA RH G APG P S T Y+ T G + R Sbjct: 230 FDQLALRAPLGQNTVLLQGPRKAREAERHMGLAPGVPHSDTNWCGDLDYIGTDGDAQCR 288 >SB_49884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 389 RSTKSQLIKSKNFSSSSQNACTSFFGNMKSSHRHLRY 279 R+ +S L+ S+N ++QNA T+FF + K H + Y Sbjct: 16 RANESTLLTSENNDIANQNADTAFFTSKKKRHNNNSY 52 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 313 VT*RAATVIFGILYSLTSFVTVPTTTAIKPSR 218 +T R T++FGIL L + TT IKP R Sbjct: 616 ITLRPITILFGILALLLNLFVFVTTVGIKPLR 647 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.7 bits (61), Expect = 3.8 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +3 Query: 186 SRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTF 365 SRL MK PT++G+ V V+ + +T A E+ RAR+L G + Sbjct: 92 SRLYEEMKHPTQDGMFVAVNSEVSVTFVGKEKEDVTFAKCAWFER-RARMLKGFGFVTFR 150 Query: 366 DQLALRAPTGKKTVLVQGQ 422 D + + KK ++ G+ Sbjct: 151 DPATIESVLAKKPHILDGK 169 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 348 GEILTFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRS 479 GE+++ D++ +A + Q N EA R F P PG P S Sbjct: 614 GEMMSDDEMKPKARCKRSQSTPIHQENREEAHRPFTPQPGRPLS 657 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 292 RWLLFMLPKKLVHAFWLLEEKFLLLISWLFVLRLARRQYW 411 RWL ++ + L H WL ++L +SWL+ +R W Sbjct: 19 RWLNYV--RWLYHVRWLYHVRWLYHVSWLYHVRWLYHVRW 56 >SB_48685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 382 VLRLARRQYWYKVSEMLVRQCVTLALLQEHRALTLNPMFAPR 507 V+R R+ W K +++V CV LA++ L + +F R Sbjct: 34 VIRNVHREGWQKSRDLIVLNCVLLAVIMLCAMLLIAVIFCRR 75 >SB_37830| Best HMM Match : Peptidase_C54 (HMM E-Value=3.3e-11) Length = 878 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 548 LDISTTTGPCFFMSLGANIGFSVRARCSWSRAKVTHCLTSI 426 L IS +TG + MSL + FSV+ +W R + H + Sbjct: 547 LYISDSTGLSYSMSLERVLYFSVKTGSTWLRHYIDHSFVDL 587 >SB_24186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 382 VLRLARRQYWYKVSEMLVRQCVTLALLQEHRALTLNPMFAPR 507 V+R R+ W K +++V CV LA++ L + +F R Sbjct: 34 VIRNVHREGWQKSRDLIVLNCVLLAVIMLCAMLLIAVIFCRR 75 >SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1207 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 336 LAAGGEILTFDQLALRAPTGKKTVLVQGQRNAREAVRHFG 455 LA G T PT +T+ + GQ R A+R FG Sbjct: 856 LATSGNTSTTISDNTATPTSSRTMQIPGQTQGRVALREFG 895 >SB_41995| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 785 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 245 HYHGNQTLTSWLLHVARQTRHRDWW 171 HYH N+ L +L ++R WW Sbjct: 342 HYHSNEVLKDYLEMLSRTGPRHGWW 366 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 467 SWSRAKVTHCLTSISLTLYQY 405 +W RAKV HC +S S+T+ QY Sbjct: 2539 TWYRAKVLHCDSSFSITV-QY 2558 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,404,993 Number of Sequences: 59808 Number of extensions: 425979 Number of successful extensions: 1171 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -