BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31500 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 29 0.034 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 6.9 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 29.1 bits (62), Expect = 0.034 Identities = 13/58 (22%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +3 Query: 297 IDPNVGLTELPEEYFEGESEA-MRLDKGVMQEIVGAFPGIDEAMSYAE-VMKLVKGMN 464 +DP + + + P + +GE ++ + ++ V+ + P ++A+ A +++L +GMN Sbjct: 64 VDPEIDIEDKPAQKIDGEDDSGLTEEEVVLSNAIAEGPDAEKALQRAALILRLREGMN 121 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 247 ENFWSNASEILWA 209 E FWSNA+ WA Sbjct: 264 ERFWSNATVDDWA 276 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,873 Number of Sequences: 336 Number of extensions: 2643 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -