BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31500 (668 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccha... 206 3e-54 SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyc... 29 0.61 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 28 1.1 SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosacch... 27 3.2 SPCC1450.08c |wtf16||wtf element Wtf16|Schizosaccharomyces pombe... 26 4.3 SPAC926.02 |||conserved fungal protein|Schizosaccharomyces pombe... 26 5.6 SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom... 26 5.6 SPCC962.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 7.5 SPAC17A5.12 |ucp7||UBA/TPR/DNAJ domain protein Ucp7|Schizosaccha... 25 7.5 >SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 206 bits (502), Expect = 3e-54 Identities = 98/188 (52%), Positives = 130/188 (69%) Frame = +3 Query: 45 FEPLEPSLKNVIDQKSLRWIFXXXXXXXXXXXCSCSLAVQLSKVRESVLIISTDPAHNIS 224 F+PL +L+N+++Q SL+WIF SCSLA+Q+SKVR SVL+ISTDPAHN+S Sbjct: 3 FDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNLS 62 Query: 225 DAFDQKFSKVPTKVKGFDNLFAMEIDPNVGLTELPEEYFEGESEAMRLDKGVMQEIVGAF 404 DAF KF K KV GFDNL AMEIDPN+ + E+ E+ + G+MQ++ Sbjct: 63 DAFGTKFGKDARKVPGFDNLSAMEIDPNLSIQEMTEQ--ADQQNPNNPLSGMMQDLAFTI 120 Query: 405 PGIDEAMSYAEVMKLVKGMNFSAVVFDTAPTGHTLRLLSFPQVVERGLGKLMRLKSKVAP 584 PGIDEA+++AE++K +K M F V+FDTAPTGHTLR L+FP V+E+ LGKL L S+ P Sbjct: 121 PGIDEALAFAEILKQIKSMEFDCVIFDTAPTGHTLRFLNFPTVLEKALGKLGGLSSRFGP 180 Query: 585 FINQIASL 608 INQ+ S+ Sbjct: 181 MINQMGSI 188 >SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 275 Score = 29.1 bits (62), Expect = 0.61 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 106 SLEGKAELGKLRAVAVSQFSCRKFANLC*SYQLILPTIS 222 +LE E GKLRA+ VS F L S+ I+P ++ Sbjct: 123 ALEKGVEEGKLRAIGVSNFGPHHIQELLDSHPKIIPCVN 161 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +3 Query: 351 SEAMRLDKGVMQEIVGAFPGIDEAMSYAEVMKLVKGMNFSAVVFDTAPTGHTLRLLSFPQ 530 ++A+ + ++ + +D Y ++ L+ F V+D + GH+ L SFP Sbjct: 641 TDALYSGSSICYSLIFSHSLLDLTFQYVDIASLLS--QFLLCVYDPSNVGHSFALASFPY 698 Query: 531 V 533 V Sbjct: 699 V 699 >SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 214 TISLMHSTRNFLKYQQRLKGLTTYSLWRLIRML 312 T+ L ++ +F++YQ +K T +W+LI++L Sbjct: 2 TVILQYAD-HFVEYQNDMKRYDTLHVWKLIKLL 33 >SPCC1450.08c |wtf16||wtf element Wtf16|Schizosaccharomyces pombe|chr 3|||Manual Length = 349 Score = 26.2 bits (55), Expect = 4.3 Identities = 21/69 (30%), Positives = 30/69 (43%) Frame = +1 Query: 160 FSCRKFANLC*SYQLILPTISLMHSTRNFLKYQQRLKGLTTYSLWRLIRMLD*QSCLKNI 339 F C KF NL LI T S+ + FL Y + + L ++L QSC+ + Sbjct: 168 FGCIKFGNLNLDKALICSTCSISAALLLFLLYVRLPFWTLKHMFSGLFQVLGVQSCVVIV 227 Query: 340 LKENLRL*D 366 K + L D Sbjct: 228 TKGLMYLFD 236 >SPAC926.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 443 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 65 VEKCYRSKVVKVDFRWRERRSWENYVQLQSRSSAVE 172 +++ +S +D + RER WEN +Q S+ E Sbjct: 146 IQQALQSISHSIDLQERERIEWENTIQTSSQQKYEE 181 >SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 326 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -2 Query: 310 TFGSISIANRLSNPLTFVGTLENFWSNASEILWAGSVDMIN 188 T G +S L NP F G E W LW + +N Sbjct: 226 TQGIMSARGLLENPALFAGYEETPWGCVERFLWYSTSYSLN 266 >SPCC962.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 536 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 470 TKVHAFY*FHHLSIAHSLINT 408 T+VHAFY + L + S INT Sbjct: 265 TRVHAFYSLNDLKLETSTINT 285 >SPAC17A5.12 |ucp7||UBA/TPR/DNAJ domain protein Ucp7|Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.4 bits (53), Expect = 7.5 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 446 FHHLSIAHSLINTRKSSNNLLHDTLVQS 363 F +L I H L NT + + ++HD + ++ Sbjct: 95 FENLEILHQLSNTPRDKDAVIHDKIEEN 122 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,535,150 Number of Sequences: 5004 Number of extensions: 47019 Number of successful extensions: 139 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -