BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31500 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 3.5 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 3.5 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.5 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 543 GLGKLMRLKSKVAPFINQIASLFWTS 620 G+G + +K K+ F+ +FW S Sbjct: 47 GIGDIEGIKEKLDHFLEMGVDMFWLS 72 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 543 GLGKLMRLKSKVAPFINQIASLFWTS 620 G+G + +K K+ F+ +FW S Sbjct: 47 GIGDIEGIKEKLDHFLEMGVDMFWLS 72 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 519 SFPQVVERGLGKLMRLKSKVAPFINQIASLFWTS 620 SF G+G L +K K++ FI + W S Sbjct: 37 SFMDSNSDGIGDLKGIKDKLSHFIESGITAIWLS 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,465 Number of Sequences: 438 Number of extensions: 3249 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -