BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31499 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 29 0.93 SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces po... 27 3.8 SPCC320.03 |||transcription factor |Schizosaccharomyces pombe|ch... 25 8.7 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 28.7 bits (61), Expect = 0.93 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 256 TGLKYIQNNPTLLKSVLLIQIDKTRRIFTI*ISFNK*F*LAQVKFSH 396 T L+Y+Q P ++ +++DK+ + + +SF K F LA + F H Sbjct: 237 TALRYLQKYPEPRAAIRAMRLDKSLK---VPVSFEKEFALADLAFRH 280 >SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 213 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 571 LQDVIKSLLEKVFKGF 524 L+D IK +LEKVF GF Sbjct: 69 LEDQIKKVLEKVFSGF 84 >SPCC320.03 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 867 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 562 HLAMILATCLIIGIFNMTNKKNLA 633 H LATC++IG+F++ +N A Sbjct: 754 HHFFSLATCVLIGVFDLPELQNEA 777 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,694,925 Number of Sequences: 5004 Number of extensions: 51518 Number of successful extensions: 81 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -