BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31498 (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 27 1.5 SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|ch... 25 6.1 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 25 6.1 SPAC14C4.07 |||membrane transporter|Schizosaccharomyces pombe|ch... 25 6.1 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 27.5 bits (58), Expect = 1.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 134 KPGRYVADPGRYDPSRDN 187 KPG YV+D Y P +DN Sbjct: 235 KPGSYVSDRASYTPQQDN 252 >SPAC5H10.04 |||NADPH dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 382 Score = 25.4 bits (53), Expect = 6.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 112 RVNSVVLERSVLSSFGGQRHCQRQADCQKDTHFPL 8 +VN +L+R VL FG Q + + + FPL Sbjct: 190 QVNGFLLDRFVLGGFGDQCDPEYRGSIENRCRFPL 224 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.4 bits (53), Expect = 6.1 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +3 Query: 270 DPVLLEVPEEPTSEPRRTSANTLVMLTRDPAXXXXXXXXXXXXXQSHPHTLPARWS---H 440 D +L + P P PR + + +LTRDP +HP W H Sbjct: 893 DAILSDEPLYPIHMPRDSVSILQQLLTRDPKKRLGSGPNDAEDVMTHPFFSNINWDDIYH 952 Query: 441 PHTLP 455 T P Sbjct: 953 KRTQP 957 >SPAC14C4.07 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 25.4 bits (53), Expect = 6.1 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 4 ITTENACLFGNLPVS-DSGAGRRNWKV 81 + TE +C F ++ D+ AGRR+W V Sbjct: 372 LCTEESCEFHQYDINADTHAGRRHWDV 398 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,786,215 Number of Sequences: 5004 Number of extensions: 28717 Number of successful extensions: 91 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -