BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31497 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.3 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.3 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.3 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.3 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 2.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 2.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 2.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.3 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.4 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSRYSRERSCSRDRN 231 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSRYSRERSCSRDRN 231 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSHYSRERSCSRDRN 242 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSHYSRERSCSRDRN 242 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSHYSRERSCSRDRN 242 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSHYSRERSCSRDRN 242 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSHYSRERSCSRDRN 231 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSHYSRERSCSRDRN 242 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSRYSRERSCSRDRN 231 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSRYSRERSCSRDRN 231 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 213 FQHTSSRYSRERSCSRDRN 231 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 229 FQHTSSRYSRERSCSRDRN 247 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R RSC R RN Sbjct: 224 FQHTSSRYSRERSCSRDRN 242 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +1 Query: 310 FEDLLNVYFQNFKIEGTSKPWKAFLGDWIHD 402 F+DL + Y++ +K+ + +F+G + D Sbjct: 398 FKDLQDKYYEEYKMYELGELASSFVGPKVKD 428 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 655 FKYKRSGYNRLRSCIRIRN 711 F++ S Y+R R C R RN Sbjct: 224 FQHTSSRYSRERRCSRDRN 242 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,965 Number of Sequences: 438 Number of extensions: 3630 Number of successful extensions: 33 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -