BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31495 (503 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.3 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 6.3 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 6.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.3 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 8.3 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 8.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 340 AFEADPLGTPRDHMDVLLAQAHG 408 A++ LGT D M V+ HG Sbjct: 816 AYDLPALGTVLDFMSVMTYDYHG 838 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/37 (21%), Positives = 16/37 (43%) Frame = +1 Query: 148 LVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESK 258 L+P P + + PG + L P + + P ++ Sbjct: 85 LMPSPTVSGSEMSSPGAGSGNLSPQIQTQVARPPPAR 121 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/37 (21%), Positives = 16/37 (43%) Frame = +1 Query: 148 LVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESK 258 L+P P + + PG + L P + + P ++ Sbjct: 85 LMPSPTVSGSEMSSPGAGSGNLSPQIQTQVARPPPAR 121 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 6.3 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 244 KPESKLAP-LAPYVSPREQTRARVLSTVGQRERAFEADPLGTPR 372 K E + P ++P SPR+ S +D GTPR Sbjct: 904 KEEDEDKPSVSPLTSPRQPAETHAGSPCRNSASPASSDRSGTPR 947 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 8.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 79 TCRADASCRSHSRIP 35 +C AD SC S + P Sbjct: 115 SCHADKSCASDDKSP 129 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 20.6 bits (41), Expect = 8.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 268 EAPTSTPVSAGCFV 227 E+ TSTPVS F+ Sbjct: 14 ESNTSTPVSKSAFI 27 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,737 Number of Sequences: 336 Number of extensions: 1917 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -