BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31495 (503 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 36 0.014 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 30 0.94 SB_59064| Best HMM Match : Adeno_E1A (HMM E-Value=9.3) 29 2.2 SB_27470| Best HMM Match : Baculo_PEP_C (HMM E-Value=2.8) 29 2.2 SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 29 2.9 SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 28 3.8 SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 28 3.8 SB_55995| Best HMM Match : F5_F8_type_C (HMM E-Value=4.9e-15) 28 5.0 SB_42630| Best HMM Match : Ets (HMM E-Value=0) 27 6.6 SB_20247| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) 27 6.6 SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 27 6.6 SB_29976| Best HMM Match : PT (HMM E-Value=5.9) 27 6.6 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 27 6.6 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.3 bits (80), Expect = 0.014 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +1 Query: 91 VTRSTLGDWE-KVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPP-KPESKLA 264 VT +T E K P P PS +P P T + P A P+ + +PP P A Sbjct: 164 VTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPA 223 Query: 265 PLAPYVSPREQTRARVLST 321 PL P++ P ++ ++T Sbjct: 224 PLHPHIPPAPPNPSKAIAT 242 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +1 Query: 124 VPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSP 288 +P P P P+P F P P PP P LAP PY+ P Sbjct: 247 MPETPLPPATPNP---FIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPP 298 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 30.3 bits (65), Expect = 0.94 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +1 Query: 127 PFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSPR 291 P P P+++ P T+ T P S P P + +S PL Y +PR Sbjct: 141 PCTPVPAVLHSPRTSLAVYTSPRVHNSPRTPFLAYTSPREHQSPRTPLPAYFTPR 195 >SB_59064| Best HMM Match : Adeno_E1A (HMM E-Value=9.3) Length = 336 Score = 29.1 bits (62), Expect = 2.2 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +1 Query: 142 PSLVPDPVTAFGRRTKPGTRASV-LDPVTKQNIPPKPESKLAPLAPYVSPREQTRARVLS 318 PS+ P P+ + R +P + + DPV KQ IPPK K Y+ R++ +S Sbjct: 269 PSVAPVPIIS---RKEPDFQTPLKTDPVFKQPIPPKSSRKTPNPLKYM-----LRSKSVS 320 Query: 319 TVGQRERAFEADPLGT 366 T +++ E P+ T Sbjct: 321 T-PNKQKHIECKPMST 335 >SB_27470| Best HMM Match : Baculo_PEP_C (HMM E-Value=2.8) Length = 627 Score = 29.1 bits (62), Expect = 2.2 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +1 Query: 133 VPRPSLVPDPVTAFGRRTKPGTRASVLD-PVTKQNIPPKPESKLAPLAPYVSPREQTRAR 309 V RP +P VT + GTR L VT+ + P+ ++L L P V R T R Sbjct: 191 VTRPDTLPRVVTCLDTLPRVGTRLDTLPRVVTRLDTLPRVVTRLDTL-PRVVTRLDTLPR 249 Query: 310 VLSTVGQRERAF-EADPLGTPRDHMDVL 390 V++ + R D L PR +D L Sbjct: 250 VVTRLDTLPRVVTRLDTL--PRTRLDTL 275 >SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 162 RVGHETRPRHERHLLPVPERRPRHAVGGPVGPTRRVEVTLVYHG 31 ++ + RPRH RH+ E RH G P R V + HG Sbjct: 257 KISNTKRPRH-RHISLCQETITRHGPGTITTPPRHVPDNITRHG 299 >SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 683 Score = 28.7 bits (61), Expect = 2.9 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = +1 Query: 58 TTRRPYRSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNI 237 TTRRP +ST+ + T + P +P+ P T RRT+ T + + Sbjct: 509 TTRRPRKSTHRPKKPTRRPRKNSPRTRKPTRRPRKNTHKSRRTRKTTPQPTTQYYSTSHD 568 Query: 238 PPKPESK 258 P +SK Sbjct: 569 PMTSQSK 575 >SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.7 bits (61), Expect = 2.9 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = +1 Query: 58 TTRRPYRSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNI 237 TTRRP +ST+ + T + P +P+ P T RRT+ T + + Sbjct: 146 TTRRPRKSTHRPKKPTRRPRKNSPRTRKPTRRPRKNTHKSRRTRKTTPQPTTQYYSTSHD 205 Query: 238 PPKPESK 258 P +SK Sbjct: 206 PMTSQSK 212 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 118 EKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAP 267 +++P RP L+P R T P T + P T P KP + P Sbjct: 23 QQIPHHQRPPLLPSQQLPHNRTTTPTTPTTTTPPAT--TTPTKPTNTTPP 70 >SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1422 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 186 GAPPEGCHRVGHETRPRHERHLLPVPERRP 97 G PPEG H+ H P E+H PER P Sbjct: 1061 GTPPEGHHKHRHRGSPASEQH-GDRPERPP 1089 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -1 Query: 425 AACSGRPCAWASSTSMWSRGVPRGSASNARSRCPTVERTRARVCSRGDT*GARGAN 258 A SG P + ++S + G P A + + PT S G T G+ GAN Sbjct: 543 AGTSGAPTSVPPASSAPASGAPPSGAPASGATTPTTGPISGAPASNGPTSGSTGAN 598 >SB_55995| Best HMM Match : F5_F8_type_C (HMM E-Value=4.9e-15) Length = 335 Score = 27.9 bits (59), Expect = 5.0 Identities = 26/69 (37%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +1 Query: 142 PSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESK---LAPLAPYVSPREQTRA-R 309 P L A RRT P TRA VL + + N K LA +A V + T A R Sbjct: 88 PVLAKMAELALTRRTTPATRALVLVGIRELNAKIKSNRATPVLARMAELVLTKRTTPATR 147 Query: 310 VLSTVGQRE 336 L VG RE Sbjct: 148 ALVLVGIRE 156 >SB_42630| Best HMM Match : Ets (HMM E-Value=0) Length = 631 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +1 Query: 226 KQNIPPKPESKLAPLAPYVSPREQTRARVLSTVGQRERAFEADPLGTPRDHMD 384 + +PP P +PL SP E LS +R + E + T HM+ Sbjct: 71 RTGLPPVPPLVSSPLPSPTSPGELPYLPTLSPTSRRSSSSEVSVVVTTSSHME 123 >SB_20247| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) Length = 356 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Frame = +1 Query: 43 ESDFYTTRRPYRSTYSVT-----RSTLGDWEKVP-FVPRPSLVPDPVTAFGRRTKPGTRA 204 +S F TT RP++ST++ T +STL +P + P+P +AF +P + Sbjct: 143 QSTFTTTARPFQSTFTTTERPNSQSTLTQIGPMPKSTVNATARPNPHSAFTTTARPNPYS 202 Query: 205 SV 210 ++ Sbjct: 203 TI 204 >SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 977 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +1 Query: 226 KQNIPPKPESKLAPLAPYVSPREQTRARVLSTVGQRERAFEADPLGTPRDHMD 384 + +PP P +PL SP E LS +R + E + T HM+ Sbjct: 417 RTGLPPVPPLVSSPLPSPTSPGELPYLPTLSPTSRRSSSSEVSVVVTTSSHME 469 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 27.5 bits (58), Expect = 6.6 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 7/89 (7%) Frame = +1 Query: 127 PFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPL-------APYVS 285 P +P+PS DPV+ T PG + L T PP + P +P +S Sbjct: 1188 PDMPKPSTNNDPVSQPLFITTPGALFTPLPHETSATSPPYTSASPVPTTTPSASSSPTIS 1247 Query: 286 PREQTRARVLSTVGQRERAFEADPLGTPR 372 P + A+ STV ++ P+GT R Sbjct: 1248 PIGSSLAQ-CSTVDSMDKP-SLRPIGTER 1274 >SB_29976| Best HMM Match : PT (HMM E-Value=5.9) Length = 342 Score = 27.5 bits (58), Expect = 6.6 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = +1 Query: 163 VTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSPREQTRARVLSTVGQRERA 342 VTAF R + + + NIPP K A L SP RA +++T Sbjct: 168 VTAFPRWAREMIQYQAIISSAAANIPPSIAPKTALLVNTASPHTAHRAFIVTTCASTSTE 227 Query: 343 FEADPL 360 A P+ Sbjct: 228 SPAVPV 233 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 27.5 bits (58), Expect = 6.6 Identities = 28/88 (31%), Positives = 37/88 (42%), Gaps = 1/88 (1%) Frame = -1 Query: 491 NDSATAQSSQ-YVA*LL**T*RCAACSGRPCAWASSTSMWSRGVPRGSASNARSRCPTVE 315 ND A + S+ V +L T R S +P + W +G + R R V+ Sbjct: 16 NDGAINKCSKTLVLTILASTLRKDTFSPKPDLATGLPTSWPQGDAATGRGSTRDR-RRVK 74 Query: 314 RTRARVCSRGDT*GARGANFDSGFGGMF 231 +TRA V RG G G F G GG F Sbjct: 75 KTRASVGGRGGGFGG-GGGFGGGGGGGF 101 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +1 Query: 178 RRTKPGTRASVLDPVTKQNIPPKPESKLAPLAP-YVSPREQTRARVLSTVGQRERAFEAD 354 ++ KP S PV+ + +P K AP +P P + +A+ L+ V A +AD Sbjct: 768 KKPKPAPPPSPKKPVSSKKVPTAAAKKAAPASPAKAKPTPKPKAK-LTVVQGDIAAIDAD 826 Query: 355 PLGTP 369 + P Sbjct: 827 AVVLP 831 >SB_45212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 27.1 bits (57), Expect = 8.8 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 69 ALQVHL--QRDAVDARGLGEGAVRAAAESRARPGDSLRAAHQAGHARL 206 +L +HL QRD D R GAV+ A E + R D + + A H L Sbjct: 373 SLMLHLGGQRDEFDLRWRSAGAVKRAMEDKMRILDRVSSQLTALHKTL 420 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,957,055 Number of Sequences: 59808 Number of extensions: 290845 Number of successful extensions: 1135 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -