BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31485 (611 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0P8J2 Cluster: Putative sugar transferase; n=11; Campy... 33 7.1 >UniRef50_Q0P8J2 Cluster: Putative sugar transferase; n=11; Campylobacter jejuni|Rep: Putative sugar transferase - Campylobacter jejuni Length = 625 Score = 32.7 bits (71), Expect = 7.1 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = -1 Query: 344 IEYYIFKDLVIILLTDNKGDN*IKFTNKIMFILQRR*SNEFFVI*QQYIYLFYTIKLDCV 165 IE++ F ++ I + D GD + K+ IL ++ I Q +Y T+ L C+ Sbjct: 412 IEFFRFNKIIYIDMMDIVGDKTLFTLEKLSKILNFSSPDKNNKIFYQQLYSPLTVLLPCI 471 Query: 164 IVVNNNEKM 138 I VNN K+ Sbjct: 472 IKVNNKVKI 480 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,089,283 Number of Sequences: 1657284 Number of extensions: 8705761 Number of successful extensions: 14501 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14500 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43977329078 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -