Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31485
         (611 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q0P8J2 Cluster: Putative sugar transferase; n=11; Campy...    33   7.1  

>UniRef50_Q0P8J2 Cluster: Putative sugar transferase; n=11;
           Campylobacter jejuni|Rep: Putative sugar transferase -
           Campylobacter jejuni
          Length = 625

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = -1

Query: 344 IEYYIFKDLVIILLTDNKGDN*IKFTNKIMFILQRR*SNEFFVI*QQYIYLFYTIKLDCV 165
           IE++ F  ++ I + D  GD  +    K+  IL     ++   I  Q +Y   T+ L C+
Sbjct: 412 IEFFRFNKIIYIDMMDIVGDKTLFTLEKLSKILNFSSPDKNNKIFYQQLYSPLTVLLPCI 471

Query: 164 IVVNNNEKM 138
           I VNN  K+
Sbjct: 472 IKVNNKVKI 480


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 500,089,283
Number of Sequences: 1657284
Number of extensions: 8705761
Number of successful extensions: 14501
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14090
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14500
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43977329078
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)