BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31485 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.4 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 5.4 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 7.2 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 327 KNIIFDLKNGM-MNSWQNNRFSSFVNQIQLIHYYDNRAMDV 446 KN+ NG + S QN F+ +N +Q++H DNR ++ Sbjct: 818 KNMRVLYVNGSGIESIQNRTFNG-LNNLQILHLEDNRIREL 857 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +3 Query: 354 GMMNSWQNNRFSSFVNQIQLIHYYDN 431 GM+ + ++ F +++ L+H Y N Sbjct: 512 GMVRIFLGPKYDEFGHEVDLVHNYMN 537 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +3 Query: 354 GMMNSWQNNRFSSFVNQIQLIHYYDN 431 GM+ + ++ F +++ L+H Y N Sbjct: 512 GMVRIFLGPKYDEFGHEVDLVHNYMN 537 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +3 Query: 354 GMMNSWQNNRFSSFVNQIQLIHYYDN 431 GM+ + ++ F +++ L+H Y N Sbjct: 138 GMVRIFLGPKYDEFGHEVDLVHNYMN 163 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 512 FRRLFFSPGHFGHLSSITNAN 574 ++R+F + G FG L +TNA+ Sbjct: 3 WQRVFLAVGLFGVLLLLTNAD 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,142 Number of Sequences: 438 Number of extensions: 3004 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -