BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31476 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.13 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 25 0.67 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 1.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 364 CIFYFF----IFLCQILKIKIRIS*RTHTYYF*CGLLTGLC 474 CI+YF+ +F C + + + YYF C L+ LC Sbjct: 257 CIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCALIILLC 297 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 24.6 bits (51), Expect = 0.67 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 182 CTKTAVHRTPKFVHLLGHNTWKTW 253 C++ T K +H L HN + W Sbjct: 73 CSEKQKEMTKKVIHFLSHNKQQMW 96 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 335 LKMCSGNFSISYSLRFKLDFILTDYNFTMFSTYY 234 +++ GN + + R KLDFI T Y+ Sbjct: 428 IELLVGNLGMRRNFRKKLDFIFTFITLLTIGLYF 461 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 92 CSKFVIFFMVTVHFIYIFLYCY 27 C K+ + + VTV +Y+ L Y Sbjct: 1001 CLKYGVIYYVTVPSMYLLLVIY 1022 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 92 CSKFVIFFMVTVHFIYIFLYCY 27 C K+ + + VTV +Y+ L Y Sbjct: 1001 CLKYGVIYYVTVPSMYLLLVIY 1022 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,492 Number of Sequences: 336 Number of extensions: 3244 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -