BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31476 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 27 0.37 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 27 0.37 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 1.1 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 7.9 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.9 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 27.5 bits (58), Expect = 0.37 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 105 AKSHPGETCGSNGLPLTPSSIS-ILGR 182 A +HPG TC G PLT + + ILGR Sbjct: 387 AGAHPGPTCYRKGGPLTVTDANLILGR 413 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 27.5 bits (58), Expect = 0.37 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 105 AKSHPGETCGSNGLPLTPSSIS-ILGR 182 A +HPG TC G PLT + + ILGR Sbjct: 387 AGAHPGPTCYRKGGPLTVTDANLILGR 413 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 603 HYCFTAEIGRAVVPTRADSHEVLPPVKNIC*C 508 H F AEIG ++V DS E+LP N C Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPANFPTC 970 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 39 KDIYKMHSDHEENYKFAACTFFAKSHPGETC 131 K + K H ++ N + A T AK+H TC Sbjct: 395 KQLLKRHMNYYHNPDYVAPTPKAKTHICPTC 425 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 159 SSISILGRAQRLLSIEHPNLCTYLDI 236 SS L A + S+EHPNL L + Sbjct: 877 SSKEFLEEAYIMASVEHPNLLKLLAV 902 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,998 Number of Sequences: 2352 Number of extensions: 11799 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -