BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31473 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. 27 0.52 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 27 0.52 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 27 0.68 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 0.90 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.2 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 2.1 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 25 2.8 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 3.7 AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodi... 23 6.4 AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodi... 23 6.4 AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodi... 23 6.4 AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodi... 23 6.4 AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodi... 23 6.4 AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodi... 23 6.4 AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodi... 23 6.4 AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodi... 23 6.4 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 23 6.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 6.4 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 6.4 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 6.4 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 6.4 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 8.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 8.4 >Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 27.1 bits (57), Expect = 0.52 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 68 VLVVLLLAKLCGQRRVALRHQ 6 +L VL++A C Q RVAL+H+ Sbjct: 9 LLAVLVVAVACAQARVALKHR 29 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 27.1 bits (57), Expect = 0.52 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 545 TRLPTYSCCCRSQQYRLRVIRFVPGLYDQRVD 640 TR+ Y+ ++ R RV+RFVP Y+QR + Sbjct: 352 TRMEFYNL--KNYLKRFRVVRFVPESYEQRAE 381 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 26.6 bits (56), Expect = 0.68 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 95 QRSRTLDREADGRRHRHRNGPAGLSGRPAAQT*RVRSWS 211 +RSR+ R G R R R+G +G A R RS S Sbjct: 1063 RRSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRSRSRS 1101 Score = 26.2 bits (55), Expect = 0.90 Identities = 23/95 (24%), Positives = 37/95 (38%) Frame = +2 Query: 86 RKGQRSRTLDREADGRRHRHRNGPAGLSGRPAAQT*RVRSWSVRLQATHRGTRTHPPGCP 265 R RSR+ A G R R R+G G R +++ R +S R + +R+ Sbjct: 1100 RSRSRSRSRSGSAKGSRSRSRSGSGGSRSRSRSRS-RSQSAGSRKSGSRSRSRSGSQASR 1158 Query: 266 GRHDLRKQIFTIHNGDSARRLGTAPDLDQPHHQRS 370 G R + + S R G+ P ++S Sbjct: 1159 GSRRSRSRSRSRSGSRSRSRSGSGSRQASPISRKS 1193 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 26.2 bits (55), Expect = 0.90 Identities = 23/83 (27%), Positives = 30/83 (36%), Gaps = 3/83 (3%) Frame = +2 Query: 350 QPHHQRSGEPDPHPRLQ--GYHSGATDRV-PRLIQPLRQEPHRPSAARGVEIVLSLPGLQ 520 Q HH R+ +P P +Q Y R P L+ P Q+ + G PG+ Sbjct: 56 QVHHHRAQDPTPQQYIQTDQYQYAQPQRQHPSLVGPQLQQQQQQHQQHGPSGPQYQPGVP 115 Query: 521 HRQGQARRTRLPTYSCCCRSQQY 589 R P Y RSQ Y Sbjct: 116 LAPYPTETQRSPAYG---RSQAY 135 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.8 bits (54), Expect = 1.2 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 3/93 (3%) Frame = +3 Query: 384 LTRDSKGITQEQLTEFRASFNHFDKNRTGRLLPEELKSCL--VSLGYSIGKDRQGELDFQ 557 LTRD + L EF ++ +D + GR+ ++ + L +S GK + + Sbjct: 1431 LTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRVACK 1490 Query: 558 RILAVVDP-NNTGYVSFDSFLDFMTRESTDTDT 653 R++++ P N+ G V F++ L + R S T Sbjct: 1491 RLVSMNMPLNSDGTVLFNATLFAVVRTSLKIKT 1523 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 276 SCLPGQPGGCVRVPR 232 SC PGQP CV +PR Sbjct: 70 SC-PGQPSKCVTIPR 83 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.6 bits (51), Expect = 2.8 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +3 Query: 474 LLPEELKSCLVSLGYSIGKDRQGELDFQRILAVVD--PNNTGYVSFDSFLDFMTRESTDT 647 +LPEEL+ + + G++ G + RI A ++ NT S D LD T Sbjct: 151 ILPEELEFIKLEVRREFGEEEAGWRESSRISARLNTIDQNTSRASEDRDLDEPTAPGLSV 210 Query: 648 D 650 D Sbjct: 211 D 211 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 3.7 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 301 TQWRLCASAGNSS*PRSTAPSTKWR-TRSSPATPRVSLRSN*QSSA 435 ++WR G +ST P++ R RSSPA+P S +S SA Sbjct: 1437 SRWRDMEEGGR----QSTPPASPARLARSSPASPTPSKKSKRHQSA 1478 >AY825878-1|AAV70441.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825877-1|AAV70440.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825876-1|AAV70439.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825875-1|AAV70438.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825874-1|AAV70437.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825873-1|AAV70436.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825872-1|AAV70435.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825871-1|AAV70434.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825870-1|AAV70433.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825869-1|AAV70432.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825868-1|AAV70431.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825867-1|AAV70430.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825866-1|AAV70429.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825865-1|AAV70428.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825864-1|AAV70427.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825863-1|AAV70426.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825862-1|AAV70425.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825861-1|AAV70424.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825860-1|AAV70423.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825859-1|AAV70422.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825858-1|AAV70421.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825857-1|AAV70420.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825856-1|AAV70419.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825855-1|AAV70418.1| 166|Anopheles gambiae voltage gated sodium channel protein. Length = 166 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825854-1|AAV70417.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825853-1|AAV70416.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825852-1|AAV70415.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825851-1|AAV70414.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825850-1|AAV70413.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825849-1|AAV70412.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825848-1|AAV70411.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 68 DPDGTQYVRYDQLSDFL 84 >AY825847-1|AAV70410.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 68 DPDGTQYVRYDQLSDFL 84 >AY825846-1|AAV70409.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825845-1|AAV70408.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825844-1|AAV70407.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825843-1|AAV70406.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825842-1|AAV70405.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825841-1|AAV70404.1| 160|Anopheles gambiae voltage gated sodium channel protein. Length = 160 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825840-1|AAV70403.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825839-1|AAV70402.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825838-1|AAV70401.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825837-1|AAV70400.1| 162|Anopheles gambiae voltage gated sodium channel protein. Length = 162 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 70 DPDGTQYVRYDQLSDFL 86 >AY825836-1|AAV70399.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825835-1|AAV70398.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825834-1|AAV70397.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY825833-1|AAV70396.1| 161|Anopheles gambiae voltage gated sodium channel protein. Length = 161 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 69 DPDGTQYVRYDQLSDFL 85 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 115 IQGPTALAFSANCLRRFSLFCCLRSS 38 ++ P A CLR ++ F C++S+ Sbjct: 146 LREPPAPDSGGGCLRAYTFFACIQST 171 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 576 DPNNTGYVSFDSFLDFM 626 DP+ T YV +D DF+ Sbjct: 1894 DPDGTQYVRYDQLSDFL 1910 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.4 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 424 QSSAPHSTTSTRTAQ-AVCCQRS*NRA*SPWATASARTGKENSTSNVFLLLSIPTIPATC 600 Q +A STTS+ +++ + Q+ + A P ++ S + + +S S+PT+P T Sbjct: 7 QPTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTS 66 Query: 601 HSIRSWTL*PESRR 642 R+ SRR Sbjct: 67 GEPRAAGSSSNSRR 80 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 6.4 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 424 QSSAPHSTTSTRTAQ-AVCCQRS*NRA*SPWATASARTGKENSTSNVFLLLSIPTIPATC 600 Q +A STTS+ +++ + Q+ + A P ++ S + + +S S+PT+P T Sbjct: 7 QPTASSSTTSSSSSKPSPQQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTS 66 Query: 601 HSIRSWTL*PESRR 642 R+ SRR Sbjct: 67 GEPRAAGSSSNSRR 80 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.4 bits (48), Expect = 6.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 630 WS*SPGTNRMTRSRY 586 WS SPGT+RM Y Sbjct: 397 WSPSPGTDRMCNQDY 411 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 438 SFNHFDKNRTGRLLPE-ELKSCLVSLGYSIGKDRQGELDFQRILAVVDP 581 S N N+ + + E ELK+ ++S + KDR+ +++ + V+P Sbjct: 207 SNNMLQANKPHQQVDEHELKNRIISKYSYVDKDREDSREYKPVAPKVEP 255 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 350 QPHHQRSGEPDPHPRLQGYHSGATDRVPRLIQPLRQEP 463 Q HH R+ +P P +Q TD+ + QP RQ P Sbjct: 56 QVHHHRAQDPTPQQYIQ------TDQY-QYAQPQRQHP 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,609 Number of Sequences: 2352 Number of extensions: 17231 Number of successful extensions: 97 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -