BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31464 (632 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 28 0.21 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 28 0.21 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 28 0.21 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 25 1.5 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 25 2.6 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 8.1 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 23 8.1 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 28.3 bits (60), Expect = 0.21 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +1 Query: 373 CFL-CAKCRVSLVDKQFGSKLDKIY--CGN-CYDAQFASRCDGCGEVFRA 510 C L C R L +Q+G LD+IY C N + F D C + R+ Sbjct: 211 CVLRCYMLRTGLYSEQYGPNLDRIYVQCNNYANETVFRETTDACYQRLRS 260 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 28.3 bits (60), Expect = 0.21 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +1 Query: 373 CFL-CAKCRVSLVDKQFGSKLDKIY--CGN-CYDAQFASRCDGCGEVFRA 510 C L C R L +Q+G LD+IY C N + F D C + R+ Sbjct: 195 CVLRCYMLRTGLYSEQYGPNLDRIYVQCNNYANETVFRETTDACYQRLRS 244 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 28.3 bits (60), Expect = 0.21 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +1 Query: 373 CFL-CAKCRVSLVDKQFGSKLDKIY--CGN-CYDAQFASRCDGCGEVFRA 510 C L C R L +Q+G LD+IY C N + F D C + R+ Sbjct: 211 CVLRCYMLRTGLYSEQYGPNLDRIYVQCNNYANETVFRETTDACYQRLRS 260 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 416 CLSTRETRHLAHKKQASCQCLSLYDRSLESMPM 318 CL T+ + LA +K C C+S +E+MP+ Sbjct: 354 CLPTKAAKQLAGRKLRLCGCIS---SIMEAMPV 383 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 24.6 bits (51), Expect = 2.6 Identities = 17/97 (17%), Positives = 42/97 (43%) Frame = +1 Query: 271 CYESVFANGCEECNKIIGIDSKDLSYKDKHWHEACFLCAKCRVSLVDKQFGSKLDKIYCG 450 C + + +GC++C+++ ++ LS + + + + A +++L + L G Sbjct: 231 CRDRIRQSGCDKCSEVYNTHTECLSGLGEKGYTSGIITAAAKIALTNLCPAVALS---YG 287 Query: 451 NCYDAQFASRCDGCGEVFRAGTKKMGVQDQGSGTEKC 561 + S+ G G+V+ G + + S +C Sbjct: 288 GRKPSSTCSKASGTGQVYNLSYP--GYKSRMSSCSRC 322 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 375 AGLVPVLVLVRQILRVNADDLVALFAAVGED 283 AGLVP+ L+ + RV+ L AA ED Sbjct: 894 AGLVPICHLINEDARVHQQLLAPDRAATRED 924 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.0 bits (47), Expect = 8.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 454 CYDAQFASRCDGCGEVFRAGTKKMGVQDQGSGTEKCFC 567 C DA R CG V++ +D + TE CFC Sbjct: 139 CNDAN--ERFLECGPVYQLACDSRYERDTYNCTEGCFC 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,500 Number of Sequences: 2352 Number of extensions: 10888 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -