SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31461
         (760 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z78419-6|CAB01704.1|  487|Caenorhabditis elegans Hypothetical pr...    29   4.7  

>Z78419-6|CAB01704.1|  487|Caenorhabditis elegans Hypothetical
           protein F26A3.6 protein.
          Length = 487

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = -2

Query: 330 RYLKDHLNIIKIECALDHTTEIKTSLAPSIYTYLSLSI*YNM 205
           R  +D+++ + +E +   TTEI  S  P+IY  LS  I YNM
Sbjct: 385 RTTQDYVSRLVLEYSTMRTTEILVSKDPNIYELLSF-IGYNM 425


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,759,183
Number of Sequences: 27780
Number of extensions: 211861
Number of successful extensions: 369
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 356
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 369
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1809061256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -