BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31460 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 26 6.2 SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2||... 25 8.2 SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 25 8.2 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 25.8 bits (54), Expect = 6.2 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 139 NDISSNVLYFILMDFS-VLLTCIRLASNPINNYTNNKIQH 23 N++ + ++F+L DFS VL T N +N T+ I++ Sbjct: 1606 NNLKQSEIWFVLNDFSLVLATICSCLGNLLNLVTDEDIEN 1645 >SPBC1348.10c |||phospholipase |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.4 bits (53), Expect = 8.2 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 139 NDISSNVLYFILMDFSVLLTCIRLASNPINNYTNNKIQHIFA-QPY 5 ND ++L+ IL D S I NP NYT + + A +PY Sbjct: 374 NDTYYDILHAILEDLSKHQDDIAPYPNPYQNYTTSNTSVVNAFEPY 419 >SPAC977.09c |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 673 Score = 25.4 bits (53), Expect = 8.2 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 139 NDISSNVLYFILMDFSVLLTCIRLASNPINNYTNNKIQHIFA-QPY 5 ND ++L+ IL D S I NP NYT + + A +PY Sbjct: 374 NDTYYDILHAILEDLSKHQDDIAPYPNPYQNYTTSNTSVVNAFEPY 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,887,527 Number of Sequences: 5004 Number of extensions: 57403 Number of successful extensions: 102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -