BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31456 (348 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0022 - 18992517-18993033,18993119-18993360,18993535-189939... 31 0.25 01_07_0033 - 40619145-40619658,40619761-40620002,40620178-406205... 31 0.33 01_07_0034 - 40625755-40626268,40626358-40626599,40627034-406274... 30 0.43 01_07_0009 - 40397276-40397534,40397637-40398745,40398834-403989... 30 0.57 04_03_0793 + 19699355-19699472,19700245-19700633,19700824-197010... 29 0.76 10_02_0089 - 5138048-5138561,5138864-5139105,5139712-5140079,514... 27 3.1 01_01_1106 + 8750597-8754031 26 7.1 >02_04_0022 - 18992517-18993033,18993119-18993360,18993535-18993923, 18995447-18995603 Length = 434 Score = 31.1 bits (67), Expect = 0.25 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 308 GRYMIYVK*CPLEDTKRLVT*DRICLNFTYISGLLTHRHSASSQINKI 165 GR ++V P + KR+V D CLN + + + HR SS + + Sbjct: 65 GRLKVFVYDLPSKYNKRIVAKDPRCLNHMFAAEIFMHRFLLSSAVRTL 112 >01_07_0033 - 40619145-40619658,40619761-40620002,40620178-40620566, 40621586-40621688 Length = 415 Score = 30.7 bits (66), Expect = 0.33 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 308 GRYMIYVK*CPLEDTKRLVT*DRICLNFTYISGLLTHRHSASSQINKI 165 GR +YV P + K++V D CL+ + + + HR SS I + Sbjct: 47 GRLKVYVYELPTKYNKKMVAKDSRCLSHMFAAEIFMHRFLLSSAIRTL 94 >01_07_0034 - 40625755-40626268,40626358-40626599,40627034-40627422, 40628119-40628227 Length = 417 Score = 30.3 bits (65), Expect = 0.43 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 308 GRYMIYVK*CPLEDTKRLVT*DRICLNFTYISGLLTHRHSASSQI 174 GR +YV P + K+L+ D CLN + + + HR SS + Sbjct: 49 GRLKVYVYDLPSKYNKKLLKKDPRCLNHMFAAEIFMHRFLLSSAV 93 >01_07_0009 - 40397276-40397534,40397637-40398745,40398834-40398932, 40399043-40399272,40399534-40399585,40399679-40399865, 40399987-40400193,40400283-40400449,40400804-40401094, 40401166-40401636 Length = 1023 Score = 29.9 bits (64), Expect = 0.57 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = -3 Query: 142 HYRAHHIIIDSW*KVLMIWVL*CSCLNLFFFYLLISRLAL 23 H+R ++ ++W VL++W+L L F+ +L ++ +L Sbjct: 69 HFRGWRVVRETWWWVLLLWIL-AGSLGSFYLFLFMNAQSL 107 >04_03_0793 + 19699355-19699472,19700245-19700633,19700824-19701065, 19701150-19701663 Length = 420 Score = 29.5 bits (63), Expect = 0.76 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 308 GRYMIYVK*CPLEDTKRLVT*DRICLNFTYISGLLTHRHSASSQINKI 165 GR +++ P + K++V D CLN + + + HR SS + + Sbjct: 52 GRLKVFIYDLPRKYNKKMVNKDPRCLNHMFAAEIFMHRFLLSSAVRTL 99 >10_02_0089 - 5138048-5138561,5138864-5139105,5139712-5140079, 5140862-5140943 Length = 401 Score = 27.5 bits (58), Expect = 3.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 308 GRYMIYVK*CPLEDTKRLVT*DRICLNFTYISGLLTHRHSASSQI 174 G+ +YV P + K +V D CL+ + + + HR SS I Sbjct: 33 GKLKVYVYELPPKYNKNIVAKDSRCLSHMFATEIFMHRFLLSSAI 77 >01_01_1106 + 8750597-8754031 Length = 1144 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 242 CPKLPVFLCLPTGIT*RISCNDQIELTRTRK 334 CPKL CLP IT +S +D E+ RK Sbjct: 970 CPKLRPKPCLPDAIT-DLSISDSSEILSVRK 999 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,267,963 Number of Sequences: 37544 Number of extensions: 144740 Number of successful extensions: 204 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -