Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31456
         (348 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    25   0.19 
AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.         25   0.26 
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   5.5  

>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 25.4 bits (53), Expect = 0.19
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +1

Query: 166 ILFIWLLALCLCV 204
           I+ IWLLALCL V
Sbjct: 175 IIVIWLLALCLAV 187


>AY588474-1|AAT94401.1|  104|Apis mellifera defensin 2 protein.
          Length = 104

 Score = 25.0 bits (52), Expect = 0.26
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = +2

Query: 41  QKVKEEEVEA*TS*YPNH*DLSPTVNNYVMCPIVCLSAKRLKFYLSGC-LRCV 196
           ++++EE +E  T    ++  L P  +  V C ++   +K L    S C +RC+
Sbjct: 34  RQIEEENIEPDTELMDSNEPLLPLRHRRVTCDVLSWQSKWLSINHSACAIRCL 86


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 20.6 bits (41), Expect = 5.5
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +3

Query: 69  HEHHNTQIIKTFH 107
           H HH TQ ++  H
Sbjct: 353 HHHHQTQSLQHLH 365


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,070
Number of Sequences: 438
Number of extensions: 1442
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  7936320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)