BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31455 (638 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 31 0.60 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 31 1.0 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 31 1.0 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 4.2 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 28 5.6 SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 7.4 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 27 9.7 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.085 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +1 Query: 463 IEEKRQRLEEAEKKRQAMLQAMKDA 537 +EE+R+RLE EK+RQA QAM++A Sbjct: 319 LEEERKRLENLEKERQAAQQAMQEA 343 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 31.5 bits (68), Expect = 0.60 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +1 Query: 463 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQ 630 +EE+R+R EEAEKKR+ + ++ + + KK E L QLER K +++ Sbjct: 252 MEEERKRKEEAEKKREEEERKRREEEEAAQKW---KKEEL--LRQQQLEREKEEQE 302 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +1 Query: 466 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSEN 582 EE+RQ+ EEA K+R+ L A K++SK+ +++S N Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKSSNKRKSKERSGN 1381 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +3 Query: 516 APGHE--RCQQDRTQLHHPKEERKLRFEQ 596 APGH+ RC QD +L+ K ERK R EQ Sbjct: 1105 APGHQPLRCLQDVEELYLSKVERKDRLEQ 1133 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/59 (25%), Positives = 34/59 (57%) Frame = +1 Query: 460 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLE 636 ++EEK++RL+ E+ + ++ +A K+ASK+ + T + +S N ++ K ++ Sbjct: 427 EVEEKKRRLQRYERLQSSLNEAYKEASKSSVDGT-RDESRNEEITQTSCNETSGKTPIK 484 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 460 DIEEKRQRLEEAEKKRQAMLQAMKD 534 D+EEK + LEEA+ + +A+ MKD Sbjct: 522 DLEEKAKELEEAKSENEAISGKMKD 546 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/57 (24%), Positives = 29/57 (50%) Frame = +1 Query: 466 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLE 636 EEKR EEA K+++++ + + + K T +K+ E ++ N+ ++ E Sbjct: 459 EEKRTESEEAPKRKKSLKRRLSFSRKNKAKKTEEKQDEEGEAREGTMDDNEVSQKPE 515 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/55 (23%), Positives = 28/55 (50%) Frame = +1 Query: 466 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQ 630 EE+R++ EEAE++R+ + K + +QK+ + +R + ++Q Sbjct: 636 EERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQEQQRQQELQKRQQEEKQ 690 >SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 337 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 397 RGAFLLRHEKPCAWPASL*GV 335 RGA L R+E PC W A L G+ Sbjct: 69 RGAALQRNEPPCMWIAILNGI 89 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 466 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNA 600 EE+RQ+ EEA K+R+ L + T + ++K G S A Sbjct: 537 EERRQKREEARKRREEKLAKKGPTTSTSSSRKRRRKFNRNGRSAA 581 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.129 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,857,646 Number of Sequences: 59808 Number of extensions: 206709 Number of successful extensions: 849 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -