BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31455 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 26 1.2 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 6.2 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 23 6.2 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.8 bits (54), Expect = 1.2 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 2 SPRLHIPTSLCCRSKNQC-RVTE*PTSTRATLNKQP 106 SP+LH + +CC +++ C + + P S R T +P Sbjct: 138 SPQLHGKSIVCCDNEDLCNQDLQPPYSPRTTTTPEP 173 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 6.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 312 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWI 223 PL P DVFL F V P + E W+ Sbjct: 12 PLSYPQTDVFLVCFSVVSPSSFENVKEKWV 41 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.4 bits (48), Expect = 6.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 23 TSLCCRSKNQCRVTE*PTS 79 T +CC S+ Q R + PTS Sbjct: 74 TLVCCASEQQTRTSSFPTS 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.129 0.362 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,967 Number of Sequences: 2352 Number of extensions: 6447 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -