BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31453 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 3.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 6.0 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 7.9 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/61 (18%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +1 Query: 280 VLKAQYTDSVWLRR-KDWQSASRLRQGRSLAQFVCNLYSVSCLWICTILYRYCINQTNTA 456 V+ Y W R K+ +S +++++ + + + V + I+Y C+ + Sbjct: 84 VVTTFYKRRTWTRLLKNLESCAKIKKTKRYCYYYYAFFGVHLAYGVVIIYSICVQTEKSV 143 Query: 457 F 459 F Sbjct: 144 F 144 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 328 WQSASRLRQGRSLAQFVC 381 W S S L G LA+F C Sbjct: 378 WNSISSLSHGGQLARFKC 395 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 376 VCNLYSVSCLWICTILYR 429 V L ++ +WICT++ R Sbjct: 726 VSGLVYIATVWICTLMNR 743 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = -2 Query: 433 NTDTILCISINSLHYKDYKRTALANDPASIEMRFANLYAV 314 NT+ +L ++ +L + +K PA + N+Y++ Sbjct: 67 NTEPLLSEALTNLPGEKWKEMRATLSPAFTSSKIKNMYSL 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,278 Number of Sequences: 336 Number of extensions: 3303 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -