BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31453 (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical pr... 29 2.6 AC084197-27|AAG23467.2| 314|Caenorhabditis elegans Hypothetical... 28 6.0 >U41270-5|AAA82442.2| 364|Caenorhabditis elegans Hypothetical protein AH9.4 protein. Length = 364 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -2 Query: 682 DVFIQSQFIRIFLL--FAQFNLPECW*LTLDYIVIVYNIHLFTE*TFKLLS*TRRYAFHV 509 DVF +S F + LL F + +P +TLD++V+++ F+ ++ RRYA Sbjct: 163 DVFHESAFKHVHLLDIFLFYAIPSLLRITLDFLVLIHCYSPFSVEGLDRVTIDRRYAISG 222 Query: 508 QTTPFR 491 T R Sbjct: 223 PATTKR 228 >AC084197-27|AAG23467.2| 314|Caenorhabditis elegans Hypothetical protein Y73B6BL.21 protein. Length = 314 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 322 KDWQSASRLRQGRSLAQFVCNLYSVSCL 405 KDW+S RL +F+C+L++ CL Sbjct: 74 KDWESLLRLNCHPDTQRFLCSLFAPVCL 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,712,438 Number of Sequences: 27780 Number of extensions: 313161 Number of successful extensions: 636 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -