BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31450 (754 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38821| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) 30 1.8 SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_22120| Best HMM Match : 7tm_1 (HMM E-Value=0.0013) 29 3.1 SB_20777| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19754| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_25273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_36493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_19938| Best HMM Match : TolA (HMM E-Value=0.22) 28 9.4 SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) 28 9.4 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_8274| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_38821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/97 (21%), Positives = 36/97 (37%) Frame = +2 Query: 437 TVSAMTLTLLSFWCPYAASRIASTIFPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFT 616 TVS MT+ CP + + + T Q + D +SR P+ + + Sbjct: 2 TVSQMTVKKRRITCPPMKAPLLTRRPQQTTQQKKVHADERSSRKYAIPIAELTTEMAKLL 61 Query: 617 RSSASGMT*TCSRFTRRTGSRPPVWPSRMQQLNCYLG 727 R T + + + P W +++ CYLG Sbjct: 62 RDVKVFFTKDINLERKGSPISPSTWTKANERILCYLG 98 >SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 791 Score = 30.3 bits (65), Expect = 1.8 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 2/90 (2%) Frame = -2 Query: 357 SPVDQSRSVGANSTGLIFESLGCFGAQEVIDGRDG--QCWAASVSDSVQLTEDHGWADPD 184 SP Q+ ++G+ S + E++ G DGRD + W DS + +E W P Sbjct: 581 SPPRQAEAIGS-SRDVGKETVRDGGRDSGRDGRDTGRESWRDGARDSGRDSERKRWPRPP 639 Query: 183 PHHVMRHIRVRHESSYRPRCRTVNQFSRHA 94 RH SS P +TV + S +A Sbjct: 640 SPEPARHSHPDVTSSQSPALKTVKRPSDNA 669 >SB_47930| Best HMM Match : Vicilin_N (HMM E-Value=1.3) Length = 769 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/78 (26%), Positives = 35/78 (44%) Frame = +2 Query: 446 AMTLTLLSFWCPYAASRIASTIFPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFTRSS 625 A+ LT S ++S +++++ P + SL + +C TP R + R+ Sbjct: 606 AVLLTSSSSLRTTSSSSVSTSVQPPRDTSTGRSLGGSADASCRTPRDRSRENGKNHQRTK 665 Query: 626 ASGMT*TCSRFTRRTGSR 679 +SG TCS R SR Sbjct: 666 SSGKDSTCSTRGSRDTSR 683 >SB_22053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1670 Score = 30.3 bits (65), Expect = 1.8 Identities = 21/78 (26%), Positives = 35/78 (44%) Frame = +2 Query: 446 AMTLTLLSFWCPYAASRIASTIFPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFTRSS 625 A+ LT S ++S +++++ P + SL + +C TP R + R+ Sbjct: 1273 AVLLTSSSSLRTTSSSSVSTSVQPPRDTSTGRSLGGSADASCRTPRDRSRENGKNHQRTK 1332 Query: 626 ASGMT*TCSRFTRRTGSR 679 +SG TCS R SR Sbjct: 1333 SSGKDSTCSTRGSRDTSR 1350 >SB_22120| Best HMM Match : 7tm_1 (HMM E-Value=0.0013) Length = 313 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -1 Query: 610 VAYGWRRPSYRSSAR---TRGCRVQ*TSWLTRDRRKD 509 + Y WR P YR++ R GCR+ ++RDRR D Sbjct: 276 LVYAWRLPKYRNAFREALCNGCRIV-ELVMSRDRRTD 311 >SB_20777| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = -2 Query: 357 SPVDQSRSVGANSTGLIFESLGCFGAQEVIDGRDGQCWAASVSDSVQLTED 205 S D +GAN T + S C G Q I+G D A V+DS + +D Sbjct: 194 SEEDNGSLLGAN-TEICHSSCHCQGCQSQIEGDDTPVAAREVADSCETIQD 243 >SB_19754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +1 Query: 211 RELDRIAYRRRPALAISAVDDFLRSEATKTFEDETRRIRADTAALIHRARS 363 + ++R RRP+L V F + + EDE +RA L HR RS Sbjct: 90 KRMERKKKGRRPSLFRRFVGAFRNNPSNSEAEDEESELRAPPDYLSHRRRS 140 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 29.1 bits (62), Expect = 4.1 Identities = 12/28 (42%), Positives = 21/28 (75%), Gaps = 3/28 (10%) Frame = -2 Query: 678 REPVLRVKREQVHVI---PDAELLVKWP 604 +EP++ +KRE++HV+ P AE++ K P Sbjct: 691 QEPMIEIKREEIHVVLAAPKAEIVDKPP 718 >SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +1 Query: 259 SAVDDFLRSEATKTFEDETRRIRADTAALIHRARSVVPRAKSLAPLDTIYSYSYGEP 429 + +D FL++ A + ADTAA + A V +K + L T+ S ++ P Sbjct: 661 TVLDSFLKASAAGGLGSVKAEVLADTAAALASANVQVVSSKVIGRLHTLISKTFISP 717 >SB_25273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = +2 Query: 437 TVSAMTLTLLSFWCPYAASRIASTIFPSITSQPRSSLDAATSRACTTPVRRPSPTVGHFT 616 +V+A T+T I +T+ + + A S A +T RPSPT+ H + Sbjct: 714 SVAAATVTSSPNVTTQTMPVITNTVTSTSIINSGTPTSAMASSASSTTEIRPSPTINHMS 773 Query: 617 RSSA 628 +SA Sbjct: 774 TTSA 777 >SB_36493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 547 GRGNLACVHYSGKKAFSNRRPLYKELSIRD 636 GRG L CV +K S ++P + L RD Sbjct: 62 GRGRLLCVTIRHRKPASQKKPAFSRLMKRD 91 >SB_19938| Best HMM Match : TolA (HMM E-Value=0.22) Length = 2279 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 740 LRLGLQGSSLTVAFSTARPAAASLF 666 L+LGL+G ++ +TARP A S+F Sbjct: 1019 LQLGLEGLGISFMDTTARPLAVSVF 1043 >SB_2835| Best HMM Match : Spectrin (HMM E-Value=0.14) Length = 1089 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 251 WPSLPSMTSCAPKQPRLSKMRPVEFAPT 334 W L +PK PR+ ++ V+FAPT Sbjct: 465 WDQLEENDVASPKSPRVDQVVRVQFAPT 492 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 27.9 bits (59), Expect = 9.4 Identities = 19/82 (23%), Positives = 33/82 (40%), Gaps = 2/82 (2%) Frame = -2 Query: 360 ASPVDQSRSVGANSTGLIFESLGCFGAQEVIDGRDGQCWAASVSDSVQLTEDHGWADP-- 187 A P + + G T ++ + G + + + G+C S ++ L+ W D Sbjct: 407 AKPAVTAANTGNMDTPVVNDR-GMYSCPKRMQTGPGECNPPSPKEANDLSRVKQWVDQLC 465 Query: 186 DPHHVMRHIRVRHESSYRPRCR 121 H + R +H SYR CR Sbjct: 466 AAHELETVTRSKHRKSYRHACR 487 >SB_8274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 251 WPSLPSMTSCAPKQPRLSKMRPVEFAPT 334 W L +PK PR+ ++ V+FAPT Sbjct: 164 WDQLEENDVASPKSPRVDQVVRVQFAPT 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,431,244 Number of Sequences: 59808 Number of extensions: 510807 Number of successful extensions: 1470 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1469 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -