BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31441 (584 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0346 - 2710420-2710683,2711595-2711672,2711861-2711888,271... 29 3.6 >05_01_0346 - 2710420-2710683,2711595-2711672,2711861-2711888, 2711973-2712022,2712112-2712165,2712240-2712281, 2712583-2712646,2713831-2713851,2714310-2714479, 2714746-2714910 Length = 311 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -3 Query: 411 LYHFNLKLCCQL---IEVGSCNCTFYYKTALI 325 L+HF+LKL CQL +E+ C F K + + Sbjct: 241 LHHFHLKLSCQLGKKLEMEHCQVRFLIKNSFV 272 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,600,672 Number of Sequences: 37544 Number of extensions: 221063 Number of successful extensions: 426 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -