BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31437 (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 235 4e-64 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.13 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.51 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.7 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 4.8 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.3 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.3 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.3 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 235 bits (574), Expect = 4e-64 Identities = 108/116 (93%), Positives = 114/116 (98%) Frame = +1 Query: 337 EMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKC 516 EMATAA+S+SLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 517 DVDIRKDLYANTVMSGGTTMYPGIADRMQKEITGLAPSTIKIKIIAPPERKYSVWI 684 DVDIRKDLYANTV+SGGTTMYPGIADRMQKEIT LAPST+KIKIIAPPE+KYSVWI Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWI 116 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 27.5 bits (58), Expect = 0.13 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 540 VRQHRHVRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREEVLRM 680 +++H H++ +HH + + HRP Q Q + R+E R+ Sbjct: 138 LQRHHHLQNHHH--HLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRL 182 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.4 bits (53), Expect = 0.51 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 499 NSIMKCDVDIRKDLYANTVMSGGTTMYPGIADRMQKEITGLAPSTIKIKIIAPPERKYSV 678 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 679 WI 684 WI Sbjct: 397 WI 398 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 498 QLHHEVRRRHP*GPVRQHRH---VRWYHHVPRYRRQDAEGDHRPRALDHQDQDHRSPREE 668 Q+HH++ +HP +Q +H + H + + + +A Q Q PR++ Sbjct: 167 QMHHQMHTQHPHMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQSQAASQQSQPGMHPRQQ 226 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.7 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -3 Query: 303 LLDVTNDFPLSGGGERVTPLGEDLHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 133 ++D+T S G+ V +L+ +VG A + E+G G + VT + + DT Sbjct: 18 MVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 530 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 441 R F+ L T W+ +++I RK W R Sbjct: 18 RSENDPFLKRLITGDEKWVVYNNIKRKRSWSR 49 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 530 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 441 R F+ L T W+ +++I RK W R Sbjct: 139 RNENDPFLKRLITGDEKWVVYNNIKRKRSWSR 170 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 616 GLAPSTIKIKIIAPP 660 GL P T+K KI PP Sbjct: 453 GLCPYTLKHKIRVPP 467 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -1 Query: 116 TIPVVRPEAYSESTAWMATYMAGELKVSNMIWVIFSL 6 T+P + E + AWM G L+ N + F + Sbjct: 33 TLPGYKIECVGDDIAWMKFDKEGRLRAINPEYGFFGV 69 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 498 QLHHEVRRRHP*GPVRQHR 554 QL+ +V+ H PV+QHR Sbjct: 266 QLNSDVQPGHGSPPVKQHR 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,976 Number of Sequences: 438 Number of extensions: 3469 Number of successful extensions: 27 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -