BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31435 (581 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 24 0.82 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 24 1.1 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.5 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 7.6 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 7.6 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 7.6 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 24.2 bits (50), Expect = 0.82 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +3 Query: 441 HHIPNGDMYSRRSPAPMYSGRGGPPAVAGGYERD 542 HH G+ + R+PAP G A G D Sbjct: 264 HHKCGGEEEAERAPAPAVRAAGDAAAARGAARAD 297 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 270 ARTHAGPRRTHSARHRAPPADRVRSRAP 187 A T G +TH HRA P RV + P Sbjct: 171 AFTTKGNLKTHMGVHRAKPPMRVLHQCP 198 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 276 PSARTHAGPRRTHSARHRAP 217 P+ H GP TH A +P Sbjct: 48 PAGNAHTGPTGTHDAGFPSP 67 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 483 QVIFGCTCPR*VCGEQVSGVHTVRARRSG 397 + +F C V GV +RARR+G Sbjct: 314 KALFLFACTNSCMNPVVYGVFNIRARRTG 342 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 483 QVIFGCTCPR*VCGEQVSGVHTVRARRSG 397 + +F C V GV +RARR+G Sbjct: 314 KALFLFACTNSCMNPVVYGVFNIRARRTG 342 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.0 bits (42), Expect = 7.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 Query: 455 RGHVQPKITCPHVFRAWRSTCSGRRLRERSLCTT 556 + VQP + P F C LRER++ T Sbjct: 64 KSQVQPSVITPTGFLKECYCCRESFLRERTITLT 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,433 Number of Sequences: 336 Number of extensions: 2734 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -