BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31434 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 3.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.2 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 4.2 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 3.2 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +1 Query: 547 KPTLKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEDKEKKPDWS 702 KP ++ V + E++ K + K + K +K+K +T +EE + KP W+ Sbjct: 244 KPKIEDVGEDEDEDTKKEDKKKK-------KTIKEK-YTEDEELNKTKPIWT 287 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 421 DYHERIARLEDEKFDLEYIVKR 486 DYH R F +EY+V R Sbjct: 835 DYHGAWERQTGHNFTMEYLVSR 856 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 112 LLLCWFRVSYCKN*KMALRDGLANTSHS 29 ++L FR++ +N ++A R +AN S S Sbjct: 403 VMLMQFRLTLMRNAQLAARRAIANVSVS 430 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,162 Number of Sequences: 336 Number of extensions: 2070 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -