BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31431 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 45 8e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 38 0.009 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 37 0.020 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 34 0.14 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 32 0.43 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 30 1.7 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 61.3 bits (142), Expect = 8e-10 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 575 VKAPKKRSWDTMKGVGRS*QQDGGHGKSESAKECATTHLPKQPALK 712 ++ +RS D KGVG S QQDGGHG AKEC TTHLPKQ ALK Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTTHLPKQLALK 54 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +2 Query: 575 VKAPKKRSWDTMKGVGRS*QQDGGHGKSESAKECATTHLPKQPALK 712 ++ +RS D KGVG S QQDGGHG KEC TT LPKQ ALK Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTTPLPKQLALK 54 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 54.8 bits (126), Expect = 7e-08 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +2 Query: 632 QQDGGHGKSESAKECATTHLPKQPALK 712 QQDGGHGK ESAKEC TTHLPKQ ALK Sbjct: 2 QQDGGHGKLESAKECVTTHLPKQLALK 28 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALKWMALKRFAYTLP 748 K ESAKEC TTHLPKQ ALK MALKR YT+P Sbjct: 2 KVESAKECVTTHLPKQLALKMMALKRRTYTVP 33 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 455 LN FGSS ASSAYQ WPT + H +SGF SR+S+ FKV Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 268 NRYGPPSGFPLTST*PGIVHHLSGPSICA 182 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 57 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 269 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 180 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSA Q WPT + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQISGF 494 LN FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPTWHRHQI 503 LN FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALK 712 K ESAKEC TTHLPKQ ALK Sbjct: 2 KLESAKECVTTHLPKQLALK 21 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALK 712 K ESAKEC TTHLPKQ ALK Sbjct: 8 KLESAKECVTTHLPKQLALK 27 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 631 TAGRWPWEVGIR*GVCNDSPAEATSPEMDGAEAFCLY 741 TAGRWPW++ + + +MDGA+A LY Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLY 37 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALK 712 K ESAKEC TTHLPKQ ALK Sbjct: 2 KLESAKECVTTHLPKQLALK 21 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALK 712 K ESAKEC TTHLPKQ ALK Sbjct: 8 KLESAKECVTTHLPKQLALK 27 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 631 TAGRWPWEVGIR*GVCNDSPAEATSPEMDGAEAFCLY 741 TAGRWPW++ + + +MDGA+A LY Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLY 37 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 653 KSESAKECATTHLPKQPALK 712 K ESAKEC TTHLPKQ ALK Sbjct: 87 KLESAKECVTTHLPKQLALK 106 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 631 TAGRWPWEVGIR*GVCNDSPAEATSPEMDGAEAFCLY 741 TAGRWPW++ + + +MDGA+A LY Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLY 116 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 10 ESAKECVTTHLPKQLALK 27 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 4 ESAKECVTTHLPKQLALK 21 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 659 ESAKECATTHLPKQPALK 712 ESAKEC TTHLPKQ ALK Sbjct: 10 ESAKECVTTHLPKQLALK 27 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.046 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWPT 521 LN FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 662 SAKECATTHLPKQPALK 712 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 662 SAKECATTHLPKQPALK 712 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 662 SAKECATTHLPKQPALK 712 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.7 bits (76), Expect = 0.081 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 662 SAKECATTHLPKQPALK 712 SAKEC TTHLPKQ ALK Sbjct: 5 SAKECVTTHLPKQLALK 21 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +2 Query: 575 VKAPKKRSWDTMKGVGRS*QQDGGHG 652 ++ +RS D KGVG S QQDGGHG Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHG 34 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +3 Query: 558 DEPNVVLRRLKNAHGTP*KALVAHDSRTVAMGSRNPLRSVQRL 686 DEPN LR P K + + GS NPLR QRL Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 268 NRYGPPSGFPLTST*PGIVHH 206 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 318 ISLSPLYPVPTIDLHVR 268 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 32.3 bits (70), Expect = 0.43 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 7/68 (10%) Frame = -2 Query: 627 ERPTPFMVSHERFLGALTLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVL 469 E+PTPF+ S ER RL HP ++I GP T I P + + G+L Sbjct: 58 EQPTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLL 109 Query: 468 THLKFENR 445 T+LKFENR Sbjct: 110 TNLKFENR 117 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 568 FGSSHSASSAYQNWPTWHRHQISGF 494 FGSS ASS YQN PT R GF Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGF 102 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 Query: 580 LNTTFGSSHSASSAYQNWP 524 LN FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = -2 Query: 624 RPTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 493 +PTPF+ S ER L L + GPLGT I PAS Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +3 Query: 591 NAHGTP*KALVAHDSRTVAM 650 +AH TP K LVA DSRTVAM Sbjct: 9 DAHQTPQKVLVALDSRTVAM 28 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +1 Query: 136 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDVQID 285 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,156,841 Number of Sequences: 59808 Number of extensions: 534767 Number of successful extensions: 1248 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -