BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31431 (748 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane trans... 59 1e-08 DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain conta... 30 7.7 BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4... 30 7.7 BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4... 30 7.7 >AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane transporter protein protein. Length = 283 Score = 59.3 bits (137), Expect = 1e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 206 MVNYAWSGRSQGKP*WRTVAILTCKSIVGTGYRG 307 MVNYAW+GRSQ K WR+VA+LTCKS+V GYRG Sbjct: 1 MVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRG 34 >DQ427109-1|ABD72605.1| 1048|Homo sapiens OTUD4: OTU domain containing 4 protein. Length = 1048 Score = 30.3 bits (65), Expect = 7.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 521 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 616 +GP+LV G T +++KAP SW+T+ G Sbjct: 246 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 276 >BC118653-1|AAI18654.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 7.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 521 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 616 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 >BC118572-1|AAI18573.1| 1049|Homo sapiens OTU domain containing 4 protein. Length = 1049 Score = 30.3 bits (65), Expect = 7.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 521 SGPILVSRTGAVG*TKRSVKAPKKRSWDTMKG 616 +GP+LV G T +++KAP SW+T+ G Sbjct: 247 NGPVLVEELGKKH-TSKNLKAPPPESWNTVSG 277 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,396,582 Number of Sequences: 237096 Number of extensions: 2553390 Number of successful extensions: 11796 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11796 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8959138240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -