BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31429 (765 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74510.2 68414.m08632 kelch repeat-containing F-box family pr... 30 1.9 At1g74510.1 68414.m08631 kelch repeat-containing F-box family pr... 30 1.9 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 29 3.4 At5g28210.1 68418.m03416 mRNA capping enzyme family protein simi... 29 4.5 At4g39980.1 68417.m05662 2-dehydro-3-deoxyphosphoheptonate aldol... 29 4.5 At1g72110.1 68414.m08335 expressed protein 29 4.5 At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5) M... 28 5.9 At1g05790.1 68414.m00605 lipase class 3 family protein contains ... 28 5.9 At5g25100.1 68418.m02974 endomembrane protein 70, putative TM4 f... 28 7.8 At1g80870.1 68414.m09489 protein kinase family protein contains ... 28 7.8 >At1g74510.2 68414.m08632 kelch repeat-containing F-box family protein contains Pfam:PF01344 Kelch motif, Pfam:PF00646 F-box domain Length = 451 Score = 29.9 bits (64), Expect = 1.9 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +3 Query: 222 KVSEGYGAETVKFGNEINPDGSYTYFYETNNGIAAQEQGVPRNLGGNPP--AVPVVAQG 392 K S G E + FG EI Y Y TN + + VPR L G+ + V+A G Sbjct: 185 KESLAVGTELLVFGKEIMSHVIYRYSILTNTWTSGMQMNVPRCLFGSASLGEIAVIAGG 243 >At1g74510.1 68414.m08631 kelch repeat-containing F-box family protein contains Pfam:PF01344 Kelch motif, Pfam:PF00646 F-box domain Length = 451 Score = 29.9 bits (64), Expect = 1.9 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +3 Query: 222 KVSEGYGAETVKFGNEINPDGSYTYFYETNNGIAAQEQGVPRNLGGNPP--AVPVVAQG 392 K S G E + FG EI Y Y TN + + VPR L G+ + V+A G Sbjct: 185 KESLAVGTELLVFGKEIMSHVIYRYSILTNTWTSGMQMNVPRCLFGSASLGEIAVIAGG 243 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = +3 Query: 306 TNNGIAAQEQGVPRNLGGNPPAVPVVAQGS--FSWTSPEGVPISVNYVADENGYQPTGNA 479 T+ G + G G P P + S +S TSP P S +Y Y PT + Sbjct: 1555 TSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPS 1614 Query: 480 I-PTSP 494 PTSP Sbjct: 1615 YSPTSP 1620 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +3 Query: 393 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSPPVPEQIAR---ALAYIAKNIPL 551 S+S TSP P S Y Y PT + PTSP Q A+ ++AY N L Sbjct: 1691 SYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYSPSIAYSPSNARL 1747 Score = 28.7 bits (61), Expect = 4.5 Identities = 22/72 (30%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = +3 Query: 282 GSYTYFYETNNGIAAQEQGVPRNLGGNPPAVPVVAQGSFSWTSPEGVPISVNYVADENGY 461 G + ++ G + G G P P +S TSP P S Y GY Sbjct: 1533 GGMAFSPSSSPGYSPSSPGYSPTSPGYSPTSP-----GYSPTSPGYSPTSPTYSPSSPGY 1587 Query: 462 QPTGNAI-PTSP 494 PT A PTSP Sbjct: 1588 SPTSPAYSPTSP 1599 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 393 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 494 S+S TSP P S +Y Y PT A PTSP Sbjct: 1614 SYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSP 1648 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 393 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 494 S+S TSP P S +Y Y PT A PTSP Sbjct: 1621 SYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSP 1655 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 393 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 494 S+S TSP P S +Y Y PT A PTSP Sbjct: 1670 SYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSP 1704 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 393 SFSWTSPEGVPISVNYVADENGYQPTGNAI-PTSP 494 S+S TSP P S Y GY PT + PTSP Sbjct: 1684 SYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSP 1718 >At5g28210.1 68418.m03416 mRNA capping enzyme family protein similar to mRNA capping enzyme [Xenopus laevis] GI:7239232; contains Pfam profiles PF01331: mRNA capping enzyme catalytic domain, PF03919: mRNA capping enzyme C-terminal domain Length = 625 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 423 EHLQEMSRRMSPVQRREQQGGFHQGYVELPVLGQ 322 E+ +E S+R+ P R+Q+ QG+++ P GQ Sbjct: 27 ENREEHSKRLRPTSFRDQKVTIPQGWLDCPRFGQ 60 >At4g39980.1 68417.m05662 2-dehydro-3-deoxyphosphoheptonate aldolase 1 / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1 / DAHP synthetase 1 (DHS1) nearly identical to SP|P29965 Length = 525 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +3 Query: 354 GGNPPAVPVVAQGSFSWTSPEGV-PISVNYVADENGYQPTGNAIPTSPPVPEQIARALAY 530 GG+ P Q SF++ P SVN V + +P NA+ V + AL + Sbjct: 16 GGDLSHRPSNRQSSFTFHPAVNTKPKSVNLVTAVHAAEPARNAVSVKESVASSSSGALKW 75 Query: 531 IAKNIPLKK*AINLTD 578 ++ LKK A+ L D Sbjct: 76 TPESWKLKK-ALQLPD 90 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 237 YGAETVKFGNEINPDGSYTYFYETNNGIAAQEQGVPRNL 353 +G+ T+ F N + PD ++F IAA GVP+ L Sbjct: 388 FGSTTMIFSNVVGPDEEISFFGHRIAYIAASTFGVPQAL 426 >At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5) Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563; related to glutathione-regulated potassium-efflux system protein [Escherichia coli] GP|606284|gb|AAA58147 Length = 568 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 346 VTLVETPLLFPSLHRAHSPGHLLKVFPSASITSPTRT 456 ++LV TPLLF + A + G LL+ FPS + +SP + Sbjct: 518 LSLVTTPLLFKLIPSAMNLGVLLRWFPSEN-SSPNES 553 >At1g05790.1 68414.m00605 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 687 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 488 SGDSITSGLVSVLVGDVIDADGNTFR 411 SG+S +SG +S L+GD + DG + R Sbjct: 398 SGESESSGFLSSLIGDGCECDGYSIR 423 >At5g25100.1 68418.m02974 endomembrane protein 70, putative TM4 family; Length = 644 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = -3 Query: 763 FFFFFLVKTVLYLHCIQITHYEYNGNLTFKTYLYHN*HGITDSASIVFIYSYS 605 F F FLV +L + C +IT L + YL+ +T +S V+++ Y+ Sbjct: 536 FGFLFLVFVILMVTCAEITIVLCYFQLCSEDYLWWWRSYLTSGSSAVYLFLYA 588 >At1g80870.1 68414.m09489 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 692 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = -2 Query: 557 LLERNVLGDVGKSTSDLLRHWW----GSGDSITSGLVSVLVGDVID 432 LL N + D+GK + R WW GSG+ + V +G ID Sbjct: 330 LLSPNSVLDLGKGSKQWGRDWWWKQEGSGELCSKDYVREWIGSQID 375 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,665,332 Number of Sequences: 28952 Number of extensions: 377502 Number of successful extensions: 1165 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -