BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= epV31423
(503 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_41266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2
SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6
SB_30758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 28 3.8
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44926| Best HMM Match : Attractin (HMM E-Value=7) 28 3.8
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 28 3.8
SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 28 3.8
SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 28 3.8
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 28 3.8
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 28 3.8
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 28 3.8
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_12162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2907| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_574| Best HMM Match : PapG_N (HMM E-Value=8) 28 3.8
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 28 3.8
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 28 3.8
SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 28 3.8
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56810| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 28 3.8
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45834| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 28 3.8
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) 28 3.8
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 28 3.8
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_33170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2) 28 3.8
SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) 28 3.8
SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7) 28 3.8
SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 28 3.8
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 28 3.8
SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 3.8
SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8
>SB_41266| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 660
Score = 29.9 bits (64), Expect = 1.2
Identities = 17/46 (36%), Positives = 24/46 (52%)
Frame = -3
Query: 498 STTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDP 361
STT E +SSTD EP + + + +RD R ++ D RDP
Sbjct: 195 STTETSETQSSTDTREPVNNRDTRETVNNRDTR--DTVNNRDTRDP 238
>SB_49251| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 1560
Score = 29.5 bits (63), Expect = 1.6
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -3
Query: 384 DSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDS 280
DS ++DP G+RR++ F E R V L+ D+
Sbjct: 101 DSPPIKDPPGVRRKIEEFTIEQRAVNKRRLDLLDT 135
>SB_30758| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 424
Score = 28.7 bits (61), Expect = 2.9
Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
Frame = -3
Query: 495 TTPRQERKSSTDYS-EPRHRTELYPDLRSRDARVKKKTDSIDL 370
+TP+ R+ ST S +P+ EL+ R++ A ++ TD + L
Sbjct: 227 STPQHGRRGSTQQSSQPKFVNELFYKQRAKSAHSQRPTDKLHL 269
>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2)
Length = 196
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 2 WVNNPTLGEF 11
>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
Length = 402
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 67 WVNNPTLGEF 76
>SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 111
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 156
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 111
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 163
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 40 WVNNPTLGEF 49
>SB_44926| Best HMM Match : Attractin (HMM E-Value=7)
Length = 111
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
Length = 179
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 2 WVNNPTLGEF 11
>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 111
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 162
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 193
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 70 WVNNPTLGEF 79
>SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
Length = 179
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_36156| Best HMM Match : Attractin (HMM E-Value=7)
Length = 162
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 79
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 137
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 164
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 70 WVNNPTLGEF 79
>SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 111
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
Length = 179
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 163
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 40 WVNNPTLGEF 49
>SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1)
Length = 471
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 348 WVNNPTLGEF 357
>SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 2 WVNNPTLGEF 11
>SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 163
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 40 WVNNPTLGEF 49
>SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 52
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)
Length = 128
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 162
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 2 WVNNPTLGEF 11
>SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 125
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 2 WVNNPTLGEF 11
>SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 142
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 19 WVNNPTLGEF 28
>SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)
Length = 128
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
Length = 276
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 153 WVNNPTLGEF 162
>SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 162
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 39 WVNNPTLGEF 48
>SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 80
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 40 WVNNPTLGEF 49
>SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
Length = 248
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 70 WVNNPTLGEF 79
>SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 155
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 32 WVNNPTLGEF 41
>SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
Length = 207
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 193
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 70 WVNNPTLGEF 79
>SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 3176
Score = 28.3 bits (60), Expect = 3.8
Identities = 16/37 (43%), Positives = 22/37 (59%)
Frame = -3
Query: 498 STTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKK 388
S QER++ D + PRH EL PD+R D RV ++
Sbjct: 1453 SRVESQERQTMRD-TRPRHPDELRPDIR-HDIRVAQE 1487
>SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_12162| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 268
Score = 28.3 bits (60), Expect = 3.8
Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
Frame = +2
Query: 113 NTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNAS-KAEASLAESGKDMLTVEPRESG 289
+TA E++ +F + A G K+ +A + + K + + AE+G D+L
Sbjct: 184 DTANAEKSGNF-KMDTAKSEIGGNFKMDTAKSEIGGNFKMDTANAENGVDVLKTSASMVF 242
Query: 290 GSKQCDFTSRVSHSKRETRR 349
++Q TS++ ++++TRR
Sbjct: 243 NNEQFSATSQIKGTEKDTRR 262
>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
>SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 124
Score = 28.3 bits (60), Expect = 3.8
Identities = 10/10 (100%), Positives = 10/10 (100%)
Frame = -1
Query: 32 WVNNPTLGEF 3
WVNNPTLGEF
Sbjct: 1 WVNNPTLGEF 10
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,671,349
Number of Sequences: 59808
Number of extensions: 340846
Number of successful extensions: 1650
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1649
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1099461690
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -