BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31420 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) 31 0.62 SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 2.5 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 3.3 SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 29 3.3 SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) 28 5.8 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 28 5.8 SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) 28 5.8 >SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 31.9 bits (69), Expect = 0.47 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 425 ENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 571 EN L + GK + + + I G+YEY GP + RV AD GF Sbjct: 154 ENSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 201 >SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) Length = 395 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 416 YETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 571 + ++N L + GK + + + I G+YEY GP + RV AD GF Sbjct: 315 FTSKNSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 365 >SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) Length = 541 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 396 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAP 524 PK T TRP+TR + R +T PKTK S+S+ T T P Sbjct: 270 PK-TRPKTRPKTRPKTRPKTRPKT-RPKTK-SKSKSKTKTATP 309 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = +2 Query: 290 SKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENV 469 + ++ P V +K P G DY Y + D +A YH L E +E++ Sbjct: 183 ANIIAPISVVNKF--PPGTVVDYAYNVFYQDRKIAHTPYHALTVGERDCYNARRDMLEHL 240 Query: 470 G 472 G Sbjct: 241 G 241 >SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) Length = 425 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 316 NVCGCDHLAGNVCGCDWHGNGRL 248 N GC+ GN GC++ G+ R+ Sbjct: 382 NTMGCEFQGGNTMGCEFQGDSRI 404 >SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1205 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +2 Query: 368 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 547 I+RYD + P Y E++I E K +++ G+ GF+E +G D Sbjct: 491 IVRYDRNKVPSLYQLFKFIESRIEFELRTKHKSIFGYALGVIFAGFFEGIGMFKPKLG-D 549 Query: 548 YTADENGFVA 577 +ENG VA Sbjct: 550 SKLNENGHVA 559 >SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 138 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 227 PVL +P S PRR S +LTR PA Sbjct: 111 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 140 >SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 325 LAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKV 197 L GN CG L GN CG +GN GN +G+ + V Sbjct: 238 LYGNKCGTS-LYGNKCGTSLYGNKSGTSLYGNKSGNPPDVVAV 279 >SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) Length = 304 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 138 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 227 PVL +P S PRR S +LTR PA Sbjct: 86 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 115 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = -1 Query: 310 CG-CD---HLAGNVCGCDWHGNGRL-HDGQGN 230 CG CD AG V CDW G+G L D +GN Sbjct: 667 CGPCDVAVDSAGRVIACDWSGDGVLVFDSRGN 698 >SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) Length = 546 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 408 TTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 530 T T R R+ + P RS L P+ +ASRSRD APT+ Sbjct: 262 TELTERRKRYFVS-PLRSSCLWPRGRASRSRD--GACAPTM 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,629,161 Number of Sequences: 59808 Number of extensions: 254368 Number of successful extensions: 866 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -