BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31420 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 35 0.003 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 24 3.7 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 4.8 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 34.7 bits (76), Expect = 0.003 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 482 EGIKVKGFYEYVGPDGVTYRVDYTAD-ENGFVA 577 +G V+G Y V PDG VDYTAD NGF A Sbjct: 45 DGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNA 77 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 24.2 bits (50), Expect = 3.7 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 8 RYVADPGRYDPSRDN 52 RY ++P R++PSR+N Sbjct: 72 RYWSEPKRFNPSREN 86 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 8 RYVADPGRYDPSRDNSGRYIPDNSGAY 88 R+ DP R+DP R N GAY Sbjct: 439 RFYPDPDRFDPERFNDENKHKIPLGAY 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,560 Number of Sequences: 2352 Number of extensions: 8920 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -