BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31419 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) 31 0.61 SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 2.5 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 3.3 SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 29 3.3 SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) 28 5.7 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 28 5.7 SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) 28 5.7 SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 27 9.9 >SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 419 ENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 565 EN L + GK + + + I G+YEY GP + RV AD GF Sbjct: 154 ENSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 201 >SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) Length = 395 Score = 31.5 bits (68), Expect = 0.61 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 410 YETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 565 + ++N L + GK + + + I G+YEY GP + RV AD GF Sbjct: 315 FTSKNSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 365 >SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) Length = 541 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 390 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAP 518 PK T TRP+TR + R +T PKTK S+S+ T T P Sbjct: 270 PK-TRPKTRPKTRPKTRPKTRPKT-RPKTK-SKSKSKTKTATP 309 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = +2 Query: 284 SKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENV 463 + ++ P V +K P G DY Y + D +A YH L E +E++ Sbjct: 183 ANIIAPISVVNKF--PPGTVVDYAYNVFYQDRKIAHTPYHALTVGERDCYNARRDMLEHL 240 Query: 464 G 466 G Sbjct: 241 G 241 >SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) Length = 425 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 310 NVCGCDHLAGNVCGCDWHGNGRL 242 N GC+ GN GC++ G+ R+ Sbjct: 382 NTMGCEFQGGNTMGCEFQGDSRI 404 >SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1205 Score = 28.7 bits (61), Expect = 4.3 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +2 Query: 362 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 541 I+RYD + P Y E++I E K +++ G+ GF+E +G D Sbjct: 491 IVRYDRNKVPSLYQLFKFIESRIEFELRTKHKSIFGYALGVIFAGFFEGIGMFKPKLG-D 549 Query: 542 YTADENGFVA 571 +ENG VA Sbjct: 550 SKLNENGHVA 559 >SB_30499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 132 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 221 PVL +P S PRR S +LTR PA Sbjct: 111 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 140 >SB_25844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -1 Query: 319 LAGNVCGCDHLAGNVCGCDWHGNGRLHDGQGNNAGSLVSITKV 191 L GN CG L GN CG +GN GN +G+ + V Sbjct: 238 LYGNKCGTS-LYGNKCGTSLYGNKSGTSLYGNKSGNPPDVVAV 279 >SB_43300| Best HMM Match : C2 (HMM E-Value=7.2e-05) Length = 304 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 132 PVLLEVPEEPTSEPRRTSANTLVMLTRDPA 221 PVL +P S PRR S +LTR PA Sbjct: 86 PVLNHTVVQPPSSPRRCSVQLEQILTRSPA 115 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = -1 Query: 304 CG-CD---HLAGNVCGCDWHGNGRL-HDGQGN 224 CG CD AG V CDW G+G L D +GN Sbjct: 667 CGPCDVAVDSAGRVIACDWSGDGVLVFDSRGN 698 >SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) Length = 546 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 402 TTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 524 T T R R+ + P RS L P+ +ASRSRD APT+ Sbjct: 262 TELTERRKRYFVS-PLRSSCLWPRGRASRSRD--GACAPTM 299 >SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 417 PRTRFSLKKPARSRTLAPKTKASRSRD 497 P+T+ KP +R + KTK SR++D Sbjct: 25 PKTKTKTSKPQAARQASRKTKTSRTQD 51 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 396 ATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVS 527 +TTT + P T + + S T AP T R+ +T T AP+ S Sbjct: 46 STTTTSAPSTSTT----SNSTTRAPSTSTPRAGSTTTTSAPSTS 85 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 396 ATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTVS 527 +TTT + P T + + + + T AP T R+ +T T AP+ S Sbjct: 75 STTTTSAPSTS-TPRTGSTTTTSAPSTSTPRTGSTTTTSAPSTS 117 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 405 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDS 500 TC R + SL P+ S + +P A+R RDS Sbjct: 44 TCPHCRAKASLPSPSPSPSPSPSQGATRERDS 75 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 417 PRTRFSLKKPARSRTLAPKTKASRSRDSTNTLA 515 P+T+ + KPAR R +PK K S+ +D +A Sbjct: 289 PKTKST--KPARPRQASPKAKTSKPQDQDKQVA 319 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,517,476 Number of Sequences: 59808 Number of extensions: 252873 Number of successful extensions: 877 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -