BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31416 (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical pr... 28 2.7 U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. 28 2.7 L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell m... 27 4.8 L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell m... 27 4.8 L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell m... 27 4.8 >Z68003-1|CAA91975.1| 664|Caenorhabditis elegans Hypothetical protein E02H4.1 protein. Length = 664 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 123 AAWLIDEWRNSRVNSVVLERSVLSSFGGQRHCQTQADCQKD 1 +AW D + +N + E + LS+ Q+HC+ CQ+D Sbjct: 501 SAWC-DSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQD 540 >U76403-1|AAB39735.1| 664|Caenorhabditis elegans degenerin protein. Length = 664 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 123 AAWLIDEWRNSRVNSVVLERSVLSSFGGQRHCQTQADCQKD 1 +AW D + +N + E + LS+ Q+HC+ CQ+D Sbjct: 501 SAWC-DSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQD 540 >L10986-3|AAA28018.1| 650|Caenorhabditis elegans Abnormal cell migration protein10, isoform b protein. Length = 650 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 39 GRRNWKVHSFPVQPSLLY 92 GR++WK H F ++PS LY Sbjct: 340 GRKSWKKHYFVLRPSGLY 357 >L10986-2|AAK84523.2| 667|Caenorhabditis elegans Abnormal cell migration protein10, isoform a protein. Length = 667 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 39 GRRNWKVHSFPVQPSLLY 92 GR++WK H F ++PS LY Sbjct: 357 GRKSWKKHYFVLRPSGLY 374 >L10986-1|AAR25648.1| 779|Caenorhabditis elegans Abnormal cell migration protein10, isoform c protein. Length = 779 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 39 GRRNWKVHSFPVQPSLLY 92 GR++WK H F ++PS LY Sbjct: 469 GRKSWKKHYFVLRPSGLY 486 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.317 0.135 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,730,072 Number of Sequences: 27780 Number of extensions: 148095 Number of successful extensions: 501 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -