BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31414 (727 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 39 0.11 UniRef50_Q4YPP7 Cluster: Putative uncharacterized protein; n=1; ... 33 9.5 UniRef50_A0CA79 Cluster: Chromosome undetermined scaffold_160, w... 33 9.5 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 39.1 bits (87), Expect = 0.11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 142 WVDELTVHPVLSGYWSP 92 WVDELT H VLSGYWSP Sbjct: 159 WVDELTAHLVLSGYWSP 175 >UniRef50_Q4YPP7 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 618 Score = 32.7 bits (71), Expect = 9.5 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -3 Query: 626 CSFDSKKTR*NIFKKYGFLKKAFNIPY*TI-IIVRFSTFSERRECSFRNTQWSCEYSLQI 450 C+ +++K N+F +Y L K F IPY T+ I+ +ER +F N ++ + L I Sbjct: 438 CNNNNRKK--NVFNEYNNLYKNFCIPYETMDILYNLRKENERNNTNFENNKYDAQKFLDI 495 >UniRef50_A0CA79 Cluster: Chromosome undetermined scaffold_160, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_160, whole genome shotgun sequence - Paramecium tetraurelia Length = 404 Score = 32.7 bits (71), Expect = 9.5 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Frame = -1 Query: 610 KKPA-KIYLKSTGF*KKLSTFLTKR**LYVSLPSPSVVNVHSEIRNGAANIHFKFLNINC 434 K PA K ++ + G+ + L LTK +V L + + V VHS+I+N A++H L Sbjct: 327 KHPAEKYFVLAKGY-QLLRECLTKSASSFVQLQAINYVLVHSQIQNLHAHLHLLELFYPS 385 Query: 433 GEILTKLVSKMSFLR 389 +L K S + FL+ Sbjct: 386 SPLLLKYNSSLQFLQ 400 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,432,524 Number of Sequences: 1657284 Number of extensions: 9271098 Number of successful extensions: 14841 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14838 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -