BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31414 (727 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 27 2.7 SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces p... 27 3.6 SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki... 26 4.8 SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharo... 26 6.3 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 27.1 bits (57), Expect = 2.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 499 NVHSEIRNGAANIHFKFLNINCGEILT 419 N + +RNGAA I F+ N C ++ T Sbjct: 1037 NSWASVRNGAAQILFRIFNSQCSKLGT 1063 >SPBC14C8.17c |||SAGA complex subunit Spt8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 526 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = -1 Query: 229 GAKDGTLSKIRHFPSFXXXXXXXXXXXLSWVDELTVHPVLSGYW 98 G +DG + K FPS +VD +T +L YW Sbjct: 136 GGEDGYIRKYDFFPSINGDLSLTVAQRHPFVDTVTKAGILLNYW 179 >SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase Win1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1436 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 496 VHSEIRNGAANIHFKFLNINCGE 428 +H ++RNG A +HFK I GE Sbjct: 638 LHRKVRNGCALLHFKETEILEGE 660 >SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 488 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -1 Query: 532 LYVSLPSPSVVNVHSEIRNGAANIHFKFLNINCGEILTKLVSKMSFLRIY 383 L+ P V ++ E G N HF+ GEI L+ + FL I+ Sbjct: 303 LFECFDVPVVQYMYQENIIGICNEHFEHFKNESGEIYGVLLHRWCFLEIF 352 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,524,777 Number of Sequences: 5004 Number of extensions: 44829 Number of successful extensions: 79 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -