BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31409 (711 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 4.3 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 4.3 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 206 ISSMVEWVTSLTYWLMVAAEEIVSSKDRTLTPQTP 102 +++MV ++ L + + EE + T+T QTP Sbjct: 401 LATMVTYLVVLLQFQISIPEEASPTNSTTITTQTP 435 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 331 GNQIGDVNLMFVTGSFNLS 387 G+ +GDVN+ + SF++S Sbjct: 33 GSVLGDVNISAILDSFSVS 51 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,543 Number of Sequences: 336 Number of extensions: 3715 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -