BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31405 (770 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 29 0.97 SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosacch... 25 9.1 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 28.7 bits (61), Expect = 0.97 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 130 GEFNHFHNIYIKR*LILLNPQ*GPKLFSLYLLGYDLE 20 G + H YI + L+L+NP P Y L YDL+ Sbjct: 1940 GNYLHLEE-YINKKLLLINPNEEPDSLLFYALAYDLK 1975 >SPAC2G11.02 |urb2||ribosome biogenesis protein Urb2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 25.4 bits (53), Expect = 9.1 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 9/79 (11%) Frame = -1 Query: 569 FNQTIE-STIIKAGNVTFGQLLVNQKNELLTLYSIGSHKTLLNDILD--------K*QVK 417 +NQT++ +T+I + F V + ++ ++L S + T L+ IL+ K Sbjct: 1081 YNQTLKPATLIDSALDVF-LCFVQKTSKFISLDSFNTILTALSTILNLKELECEPKDHAN 1139 Query: 416 LILYLMQVLNRIL*RRRLY 360 LIL ++Q+LN +L R Y Sbjct: 1140 LILKIIQILNGLLFNHRSY 1158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,895,085 Number of Sequences: 5004 Number of extensions: 56483 Number of successful extensions: 121 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -