BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31404 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) 31 1.2 SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7) 30 1.6 SB_486| Best HMM Match : Toxin_3 (HMM E-Value=4.5) 30 2.1 SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) 29 2.8 SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) 29 3.7 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 28 6.5 SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) 28 6.5 SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) 28 8.5 >SB_37181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ + H V ++C P RV V VFP Sbjct: 186 CSCRCVPHYVSMSMCSPSRVHVDVFP 211 >SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) Length = 519 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 160 SLCSCQSISH-VGKNICDPKRVRV*VFP 80 S CSC+ +SH V +C P RV V VFP Sbjct: 280 SSCSCRCVSHHVLMPMCSPLRVHVDVFP 307 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ + H V ++C P R +V VFP Sbjct: 130 CSCRCVPHHVFMSMCPPSRAQVDVFP 155 >SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7) Length = 186 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ +SH V ++C P R V VFP Sbjct: 74 CSCRCVSHHVLMSMCSPSRAHVDVFP 99 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ + H V ++C P R V VFP Sbjct: 46 CSCRCVPHHVLMSMCSPSRAHVDVFP 71 >SB_486| Best HMM Match : Toxin_3 (HMM E-Value=4.5) Length = 334 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ +SH V +C P RV V VFP Sbjct: 2 CSCRCVSHHVLMPMCSPLRVHVDVFP 27 >SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) Length = 1282 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ + H V K++C P R V VFP Sbjct: 563 CSCRCVHHHVLKSMCFPSRAHVDVFP 588 >SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 879 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ +SH V +C P R V VFP Sbjct: 102 CSCRCVSHHVLMPMCSPSRAHVDVFP 127 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 154 CSCQSISHVGKNICDPKRVRV*VFPEKFIQNE 59 C C+ + GK IC+ R+R+ VFP+ I + Sbjct: 742 CECEGTGYEGK-ICEKGRLRIPVFPKLEINKQ 772 >SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) Length = 540 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 154 CSCQSISH-VGKNICDPKRVRV*VFP 80 CSC+ + H V ++C P R V VFP Sbjct: 177 CSCRCVPHHVLMSMCSPSRAHVDVFP 202 >SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) Length = 533 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 154 CSCQSISHVGKNICDPKRVRV*VFPEK 74 C C S HV +IC P R V VFP K Sbjct: 230 CRCVS-HHVLMSICSPSRAHVDVFPIK 255 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,953,934 Number of Sequences: 59808 Number of extensions: 368101 Number of successful extensions: 596 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -