BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31404 (708 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81146-7|CAB03523.2| 517|Caenorhabditis elegans Hypothetical pr... 27 9.9 AF067220-1|AAK84500.1| 1014|Caenorhabditis elegans Hypothetical ... 27 9.9 >Z81146-7|CAB03523.2| 517|Caenorhabditis elegans Hypothetical protein K10D11.4 protein. Length = 517 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 468 FSLVPEAKAELKIVQNFPLKEVYVLLSILNLSFVGIENFHFFIHSG 331 FS+VP IVQ+ + E +S LNL+ G+E H SG Sbjct: 253 FSIVPIPSHHHVIVQDASMYENISQISSLNLNEFGVEVVHLNASSG 298 >AF067220-1|AAK84500.1| 1014|Caenorhabditis elegans Hypothetical protein C33E10.6 protein. Length = 1014 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -1 Query: 411 KEVYVLLSILNLSFVGIENFHFFI---HSGSEFDI 316 K +YV LSIL+LS + FH+ + H G++ D+ Sbjct: 834 KPIYVALSILDLSKTIMYEFHYDVMKKHFGNKIDL 868 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,872,119 Number of Sequences: 27780 Number of extensions: 308911 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -