BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31402 (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 35 0.065 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 35 0.065 U41270-3|ABC71846.1| 254|Caenorhabditis elegans Hypothetical pr... 28 5.7 AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical ... 28 7.5 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 34.7 bits (76), Expect = 0.065 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -1 Query: 280 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPDTSA 140 GPA GA +PSR + +P +T R P+ TP+ P + +P S+ Sbjct: 14 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPSRSS 60 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 34.7 bits (76), Expect = 0.065 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -1 Query: 280 GPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMSPQKGSPDTSA 140 GPA GA +PSR + +P +T R P+ TP+ P + +P S+ Sbjct: 143 GPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPSRSS 189 >U41270-3|ABC71846.1| 254|Caenorhabditis elegans Hypothetical protein AH9.3 protein. Length = 254 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 217 EPGSTPRCPSGTPSMSPQKGSPDTSARQNKV 125 E GS+P+ + T P+K S D +A +N+V Sbjct: 44 EAGSSPKATTTTDGEVPEKDSADENAEKNQV 74 >AF003385-1|AAB54243.1| 884|Caenorhabditis elegans Hypothetical protein R08F11.1 protein. Length = 884 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 585 GNRVTVCLFDCDGTVRRL*SEV 650 G++VT CLFD +GT RL S++ Sbjct: 305 GSKVTTCLFDPNGTGGRLWSDL 326 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,912,789 Number of Sequences: 27780 Number of extensions: 346955 Number of successful extensions: 988 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -