BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31402 (706 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02660.1 68418.m00202 hypothetical protein contains Pfam prof... 30 1.3 At5g14940.1 68418.m01753 proton-dependent oligopeptide transport... 28 5.2 >At5g02660.1 68418.m00202 hypothetical protein contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 629 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 546 LSKQKLRDCRVLCGNRVTVCLFDCD 620 +SKQKL+DCR+L ++C +CD Sbjct: 347 ISKQKLKDCRLL-ETPQSICFLECD 370 >At5g14940.1 68418.m01753 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 552 Score = 28.3 bits (60), Expect = 5.2 Identities = 25/62 (40%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = -2 Query: 657 LV*LHFTTA*RSRHNRTDKLSLYFHTTHDSLVAF---VLKGSNYIMGTARIDVVFNHSNA 487 LV L FT SR + T +SLYF T SLVA VL S G ++D +H N Sbjct: 93 LVGLTFTAFAGSR-STTKTISLYFLYTSLSLVALGLGVLNPSLQAFGADQLDYDLDHDND 151 Query: 486 SE 481 E Sbjct: 152 HE 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,800,029 Number of Sequences: 28952 Number of extensions: 304874 Number of successful extensions: 845 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 845 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -