BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31394 (766 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 25 1.0 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 1.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.4 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 4.1 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 4.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 7.2 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 7.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 123 FYSGDSYIVLNTTGDKDRLTWDIHF 197 F GD+ I +N K+++ WD F Sbjct: 666 FQPGDTIICINIKRQKEKIEWDPGF 690 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/45 (20%), Positives = 24/45 (53%) Frame = +3 Query: 438 GKRNVRVKQVKPTFESLNNGDCFILDVDHQIFVFVGEKAKGVERM 572 G N+ + + + + L + DC + ++ ++FV G+ A + ++ Sbjct: 61 GSTNIGINKWRFLLQCLEDLDCSLRKLNSRLFVIRGQPADALPKL 105 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 646 PKRTMESSTGSSMP 687 P ++ ESSTGSS+P Sbjct: 355 PPKSSESSTGSSIP 368 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 412 VPSLIVTWLKPEACP 368 V S I W+KPEA P Sbjct: 229 VMSWIAFWIKPEAIP 243 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 4.1 Identities = 23/83 (27%), Positives = 30/83 (36%), Gaps = 1/83 (1%) Frame = +1 Query: 217 ARTKPARRPSSR*TWTTNNSRDQRY-STERSNITSPRSS*NISHQPSAI*KADTPQASAT 393 +RTK R R W R+Q Y +R I SH K + S T Sbjct: 29 SRTKEERLQYRREAWLVQQEREQEYEKLKRKMILEYELYIKYSHTHE---KKLVLERSKT 85 Query: 394 *RSMREQRNDSSRSRVKETSALS 462 E R+ S+ S +T LS Sbjct: 86 KSKSPESRDRSNTSNTSKTFILS 108 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 258 LDDEQFQGSAVQHREVQYYESKEFL 332 +D EQF + VQY S++ L Sbjct: 281 VDTEQFSNPQYEENNVQYEGSQDIL 305 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 693 SGNKEAIADAEKGGDDQEF--EC 755 SGN EA+ EK QEF EC Sbjct: 133 SGNIEAVTTKEKAKFPQEFFPEC 155 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 412 VPSLIVTWLKPEACP 368 + S + W+KPEA P Sbjct: 260 IMSWVSFWIKPEAAP 274 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 237 AAILTVNLDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKGGHASGFS 389 +A L V + ++ G + + E + S E L +SP + L+ G GF+ Sbjct: 994 SAELIVRTEPQRPAGPPI-NLEARALSSSEILITWSPPLPELRHGDIQGFN 1043 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.5 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +3 Query: 237 AAILTVNLDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKGGHASGFS 389 +A L V + ++ G + + E + S E L +SP + L+ G GF+ Sbjct: 990 SAELIVRTEPQRPAGPPI-NLEARALSSSEILITWSPPLPELRHGDIQGFN 1039 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,856 Number of Sequences: 438 Number of extensions: 4585 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -