BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31393 (780 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0172 - 1201595-1201912,1202637-1202723,1202836-1202895,120... 29 3.1 02_04_0311 + 21936812-21937861 29 3.1 04_04_0057 + 22410167-22411330 29 4.1 05_03_0373 - 13194723-13195847,13196219-13196809 29 5.5 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 29 5.5 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 29 5.5 12_01_0951 - 9471391-9471597,9471857-9471966,9473173-9473278,947... 28 7.2 10_08_0849 + 21040043-21040199,21040620-21040678,21040925-210424... 28 7.2 12_01_0777 - 7095081-7096259,7096636-7096725,7096827-7096902,709... 28 9.6 01_06_0751 + 31690411-31690443,31692900-31694240 28 9.6 01_03_0163 + 13346586-13347809 28 9.6 >07_01_0172 - 1201595-1201912,1202637-1202723,1202836-1202895, 1203007-1203106,1203227-1203633,1204728-1204883, 1204981-1205106,1205503-1205572,1205679-1205767 Length = 470 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 530 DPQPPAAVLAS--SPFVTSQPTEELLREFETVYGAVELTHL 646 DP PA V S SP + QP EL+RE T+ +E+ HL Sbjct: 78 DPDHPAPVNLSLESPMLKVQPANELIREVATL--ELEIKHL 116 >02_04_0311 + 21936812-21937861 Length = 349 Score = 29.5 bits (63), Expect = 3.1 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +2 Query: 464 WLEEKVDLPSIFENISEVPERVDPQPPAAVLASSPFVTSQPTEE 595 WLE V P N+ + P P PPA +SSP + EE Sbjct: 154 WLEGHVTCPLCRANLEKQPA---PSPPAVEFSSSPAAAAAAAEE 194 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 464 WLEEKVDLPSIFENISEVPERVDPQPPAAVLASSP 568 WLE +V P N+ + P P P AA + SP Sbjct: 164 WLESRVTCPLCRANLEKPPPPPPPPPAAAAASPSP 198 >05_03_0373 - 13194723-13195847,13196219-13196809 Length = 571 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 409 VSEFGGTWFQLRR*WRVETRSVIDFDLRCSAR 314 V+E G + QL+R WR + R ++D D R R Sbjct: 502 VNEAGQRFLQLQREWRSDARGIVDGDGRFKFR 533 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 28.7 bits (61), Expect = 5.5 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 1/73 (1%) Frame = +2 Query: 473 EKVDLPSIFENISEVPERVDPQPPAAVLASSPFVTSQPTEELLREFETV-YGAVELTHLT 649 E+++ P + PE + P PP A +P T PT V A L T Sbjct: 108 EEIEDPDGDSPFVDAPEHISPPPPPPPPARTPMPTPTPTPTPTPTRPPVPVWAAPLPART 167 Query: 650 PPQSPPGPADSVA 688 P +P P + A Sbjct: 168 PTPTPSAPPRAAA 180 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 28.7 bits (61), Expect = 5.5 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = +2 Query: 515 VPERVDPQPPAAVLASSPFVTSQPTEELLREFETVYGAVELTHLTPPQSPP--GPADSVA 688 VP P PPAA A + + + L +F T A +T P PP P D V+ Sbjct: 214 VPAPAPPPPPAAAPAPAAQPEQRDRDAALDQFATPAPAPAPPPVTAPPPPPVAAPNDCVS 273 Query: 689 S 691 S Sbjct: 274 S 274 >12_01_0951 - 9471391-9471597,9471857-9471966,9473173-9473278, 9474719-9475060,9475598-9475647,9476745-9477717 Length = 595 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 541 PGSGSSFKSFCDLAAH*RTAAGIRNGLWCCR 633 P GS S C + TA G+ GLWCCR Sbjct: 397 PSCGSYTASACPIYVESGTA-GVVIGLWCCR 426 >10_08_0849 + 21040043-21040199,21040620-21040678,21040925-21042494, 21042583-21042710,21042793-21043033,21043160-21043710 Length = 901 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +2 Query: 413 LLQQLDSQCKQENIFSNWLEEKVDLPSIFENISEVPERVD 532 L+ +L C ++N+ +LE+++ P +FE + +R+D Sbjct: 754 LVLELSELCAEQNLEVWYLEDELISPCMFEELQNQGDRID 793 >12_01_0777 - 7095081-7096259,7096636-7096725,7096827-7096902, 7097150-7097367,7097502-7097717,7097922-7098107, 7098181-7098303,7098399-7098514,7099254-7099832, 7101485-7101517,7102485-7103679,7103732-7103797, 7104843-7104905,7105328-7105411 Length = 1407 Score = 27.9 bits (59), Expect = 9.6 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 554 LASSPFVTSQPTEELLREFETVYGAVELTHLTPPQSPPGPADSVASE 694 +A+ V + +EEL E E Y + + L+P +P P + SE Sbjct: 81 IATLLMVEEKVSEELTSETENPYAVSDFSKLSPTANPASPPECGRSE 127 >01_06_0751 + 31690411-31690443,31692900-31694240 Length = 457 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 506 ISEVPERVD-PQPPAAVLASSPFVTSQPT 589 I E+P+R + P PPAA P T Q T Sbjct: 195 IDELPDRAEAPPPPAAASTEQPEATEQAT 223 >01_03_0163 + 13346586-13347809 Length = 407 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 212 SWAAAIDLLTNDECRLLLEVED 277 SW AA+D +T DE R LLE D Sbjct: 115 SWDAALDGITADEARALLESID 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,942,994 Number of Sequences: 37544 Number of extensions: 393389 Number of successful extensions: 1296 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -