BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31387 (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 2.1 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 2.7 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 4.8 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 4.8 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/29 (27%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +2 Query: 122 VYKPGRYVADPGRYDPSR---DNSGRYIP 199 +++ +Y DP ++DP R +N + +P Sbjct: 383 IHRDPQYFPDPEKFDPERFSDENKAKIVP 411 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 110 VSPFVYKPGRYVADPGRYDPSR 175 +S Y P Y DP +YDP R Sbjct: 393 ISGLHYDP-EYYPDPEKYDPER 413 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 603 PKTKASRSRDSTNTLAPTVSPTE*TTLLTKTGFVAD 710 P + ++ ST AP TTL TK G+V D Sbjct: 396 PVEEVTQKPSSTKAPAPPSRDLT-TTLCTKAGYVRD 430 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 633 STNTLAPTVSPTE*TTLLTK 692 S+ L PT S T TTL TK Sbjct: 157 SSTPLPPTTSTTTRTTLTTK 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,987 Number of Sequences: 336 Number of extensions: 2895 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -