BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31382 (322 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 1.2 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 20 6.4 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 1.2 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = +1 Query: 85 HRKLDPRPLVVLK*SDHITLQRILIMWLQERVPERG 192 H+ LD + + V+ ++ TLQ ++ M +++ VP+ G Sbjct: 331 HQSLDRQNIDVVARNED-TLQMVVSMKIKQNVPQSG 365 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.2 bits (40), Expect = 6.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = +3 Query: 267 CRRAGGRCWWTSRSSL 314 C GG C+W +L Sbjct: 135 CLSTGGSCYWPRGKNL 150 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,562 Number of Sequences: 438 Number of extensions: 1023 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6968808 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -